KEGG   Rickettsia bellii OSU 85-389: A1I_06680Help
Entry
A1I_06680         CDS       T00602                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00450  Selenocompound metabolism
rbo00970  Aminoacyl-tRNA biosynthesis
rbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A1I_06680
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A1I_06680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rbo01007]
    A1I_06680
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbo03016]
    A1I_06680
Enzymes [BR:rbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A1I_06680
Amino acid related enzymes [BR:rbo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A1I_06680
Transfer RNA biogenesis [BR:rbo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A1I_06680
 Prokaryotic type
   Other AARSs
    A1I_06680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 z-alpha
Motif
Other DBs
NCBI-ProteinID: ABV79652
Position
1279152..1280681
Genome map
AA seq 509 aa AA seqDB search
MNNTYYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLSGHEVMFLTGTDEHGQKVEKAA
IDKNIDPQKFTDQTSQSFRHLMTAMHISNDDFIRTTEERHKKAVAIFWQKLLDNGSIYEG
FYEGWYAVRDEAFYDESELTADKLAPTGAAVEWVKEPSYFFNLSKWQDKLLEFYEANPDF
IRPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNDNKHVIYVWLDALANYISALGYPD
QNSNYGKFWPANLQVVGKDILRFHAIYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSL
GNTIDPIKLIEEFGVDQVRYFLMREITFGADGNFARSNLITRINSELSNKIGNLLQRTTS
FVYKNNDGKVPAITQDAINKIYELPLLKTAINSAKQNILLMEKTEINKILDNIINLAEEA
NIYIDSEAPWNLKKTDPEKMLEVLYALLETLRYIAVMLQAFMPSSAGKMLDQLGVNTEER
LFKHLSLEFALTSASDILEPVIVFPRFEE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaataatacctactatattaccactcccatatattatgttaatgatgtcccgcatatt
gggcatgcttataccagcgttgcaagtgacgtgattgcccgctttatgcgtcttagcggt
catgaagtcatgtttttaaccggcactgatgaacatgggcagaaagtagaaaaagctgct
attgataaaaatattgatccgcaaaaatttactgatcagacttctcaaagttttcgtcat
cttatgactgccatgcatatttcaaatgatgattttatcagaacaacggaagaaaggcat
aaaaaagcagtagctatattttggcaaaaattactagataacggttctatctatgagggt
ttttatgaggggtggtatgccgttcgtgatgaagctttttatgatgaatctgagctaaca
gcggacaaattagccccaaccggtgcagcggtggaatgggttaaagaacctagctatttc
tttaatctctcaaaatggcaagataaattgcttgagttttatgaagcaaaccctgatttt
atcagacctatatcaagacgtaacgaggtcatcagctttgttaagtcaggtctaaaagat
ttgtccgtatcacgcaccacttttaactggggtatcaaagtcccaaacgataataagcac
gtgatttatgtgtggcttgatgcacttgctaattatatctcagctcttggctatcctgat
caaaatagcaattacggcaagttttggccagccaatttacaggtagtcggtaaagatatt
ctacgtttccatgccatttattggccagctttcttaatggctgctgaaattccgctacct
aagacaattatggcacatggctggtggactaatgaggggcagaaaatttctaaatcactt
ggtaatactattgatccgattaagctgatagaggagtttggtgttgatcaggttagatat
tttttaatgcgtgagataacatttggagcggatggtaactttgcccgcagcaatctaatt
acccgtattaatagcgaattatctaataagatcggtaatttattgcaacgtactacttct
tttgtttataaaaataatgatggcaaagtgccagcaatcacgcaagatgcaattaataaa
atatatgaattaccgcttctaaaaacagcaattaattctgccaaacagaatattttgtta
atggaaaaaaccgagattaacaagattcttgataatattattaatttagccgaagaagca
aatatttatattgatagcgaagctccttggaatttgaaaaaaacagaccctgagaaaatg
ctagaggtgttatatgctctgctagaaactttgcgttatatcgccgtaatgcttcaggct
tttatgccaagttctgccggtaaaatgcttgatcagctaggggtaaacacagaagagcgt
ttatttaagcatttatcgcttgagtttgctttaacatcagctagcgatattctagaaccg
gttatagtatttccaaggtttgaagagtaa

DBGET integrated database retrieval system