KEGG   Ruminococcaceae bacterium CPB6: B6259_00415Help
Entry
B6259_00415       CDS       T04880                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rbp  Ruminococcaceae bacterium CPB6
Pathway
rbp00010  Glycolysis / Gluconeogenesis
rbp00030  Pentose phosphate pathway
rbp00051  Fructose and mannose metabolism
rbp00680  Methane metabolism
rbp01100  Metabolic pathways
rbp01110  Biosynthesis of secondary metabolites
rbp01120  Microbial metabolism in diverse environments
rbp01130  Biosynthesis of antibiotics
rbp01200  Carbon metabolism
rbp01230  Biosynthesis of amino acids
Module
rbp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rbp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B6259_00415
   00030 Pentose phosphate pathway
    B6259_00415
   00051 Fructose and mannose metabolism
    B6259_00415
  09102 Energy metabolism
   00680 Methane metabolism
    B6259_00415
Enzymes [BR:rbp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     B6259_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase GCK AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ARP49488
UniProt: A0A1W6WBY5
Position
complement(99352..100290)
Genome map
AA seq 312 aa AA seqDB search
MALVNTRGMFKKAYDGGYAIGAFNVNNMEIIQGITEAAGELNAPVILQVSKGARAYANPT
YLVKLVEAAVAEHPEIPIVLHLDHGPSYEMCKACIDDGFTSVMFDGSSKPYEENVAESAK
VVEYAHKYNVTVEAELGTLGGVEDDVSVEADKAMYTDPDQVQDFVKRTGVDSLAIAIGTS
HGAYKFKPGQNPKLRLDILEEVSKRLPGFPIVLHGASSVPQEFVKVVNTYGGNMPNAIGI
PESELRKAAKMAVCKINVDSDIRLAMTATIRKCFHDHPDYFDPRQYLGPAREAVKDMVSH
KITDVMGCNGKA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcattagtaaacaccaggggaatgtttaaaaaagcatacgacggcggttacgcaatc
ggtgctttcaacgtaaacaatatggagattatccagggcatcaccgaagcagccggcgag
ctgaacgcgcccgtcattctgcaggtttccaagggcgcccgcgcctacgccaaccccacc
tatctggttaagctggtagaggctgctgtggcagagcatccggaaatcccgattgtgctg
catctggaccacggtccgtcctacgaaatgtgcaaagcctgcattgatgacggcttcact
tccgttatgtttgacggctcttccaagccttatgaagaaaatgttgctgaatctgcaaaa
gtcgtggagtacgcacataagtacaatgttaccgtagaagcggaactgggcaccctgggc
ggtgtggaagatgacgtttccgttgaagcggacaaggccatgtacacagaccccgaccag
gtgcaggattttgtaaagcgtaccggcgtggacagcctcgctattgccattggcaccagc
cacggggcctacaagtttaaacctggccagaacccgaagctgcgtcttgacattctggag
gaagtttccaagcgtctgcccggcttcccaattgtcctgcacggtgcttccagtgtcccg
caggaatttgtaaaggttgttaacacttacggcggcaatatgccaaatgcaatcggcatt
cctgaaagcgagctgcgcaaagccgcaaagatggctgtctgcaagattaacgtcgactcc
gacattcgtctggctatgactgctaccatccgcaagtgcttccatgaccatccggattac
ttcgacccgcgccagtaccttggacctgcacgtgaagcagtcaaggacatggtttctcac
aagattacggatgttatgggctgcaacggcaaggcctaa

DBGET integrated database retrieval system