KEGG   Ruminococcaceae bacterium CPB6: B6259_06370Help
Entry
B6259_06370       CDS       T04880                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbp  Ruminococcaceae bacterium CPB6
Pathway
rbp00071  Fatty acid degradation
rbp00280  Valine, leucine and isoleucine degradation
rbp00362  Benzoate degradation
rbp00620  Pyruvate metabolism
rbp00630  Glyoxylate and dicarboxylate metabolism
rbp00640  Propanoate metabolism
rbp00650  Butanoate metabolism
rbp00900  Terpenoid backbone biosynthesis
rbp01100  Metabolic pathways
rbp01110  Biosynthesis of secondary metabolites
rbp01120  Microbial metabolism in diverse environments
rbp01130  Biosynthesis of antibiotics
rbp01200  Carbon metabolism
rbp01212  Fatty acid metabolism
rbp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B6259_06370
   00630 Glyoxylate and dicarboxylate metabolism
    B6259_06370
   00640 Propanoate metabolism
    B6259_06370
   00650 Butanoate metabolism
    B6259_06370
  Lipid metabolism
   00071 Fatty acid degradation
    B6259_06370
   00072 Synthesis and degradation of ketone bodies
    B6259_06370
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B6259_06370
   00310 Lysine degradation
    B6259_06370
   00380 Tryptophan metabolism
    B6259_06370
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B6259_06370
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B6259_06370
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B6259_06370
Enzymes [BR:rbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B6259_06370
Exosome [BR:rbp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B6259_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: ARP50532
UniProt: A0A1W6WE34
Position
complement(1303989..1305173)
Genome map
AA seq 394 aa AA seqDB search
MSRKIVLAGACRTPIGKMGGMFVNTYTPELATIVVKEALKRSGVPAEAVDEVILGCVFQG
GIGQNVARQAAVYAGIPISTPAFTLNNLCGSGLKSINVAAGLIQAGQADIIVAGGAENMS
NAPYLLKKARFGYRLNDGVLIDSMQNDGLWDTFHHYPMGITAENVAEKYGITREMQDEFS
ANSQQKCQKALAAGKFNDEIVPVEVKQRKKTVLIDKDEAPRAGITAESISGLKPCFKEGG
TVTAANSSGINDAASAVVVMTEEKAKELGVKPLAFWIDGASAGVDPAYMGLGPIDATKKV
MKHSGMSVKDMDLVEANEAFAAQSIEVCRELNFDMDKVNVNGGAIALGHPVGCSGCRILT
TLMYEMQRRQSEYGLATLCVGGGMGVATIVKRYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaaaaatcgtattagcaggtgcctgccgtacgcctatcggaaaaatgggcggc
atgttcgtgaatacctacacccctgaactggctactatcgtagttaaggaagctctgaag
cgttccggtgttccagcagaggctgttgatgaagttatcctgggctgcgtgttccagggc
ggcatcggccagaacgttgcccgtcaggctgctgtttatgcaggtatcccgattagcact
cctgctttcacactgaacaacctgtgcggctccggtctgaagagcatcaacgttgctgca
ggcctcattcaggctggccaggctgacattattgtcgccggcggcgctgagaacatgtcc
aacgctccttatctgctgaaaaaagcacgttttggctatcgcctgaacgacggtgttctc
attgactccatgcagaacgatggtctgtgggatactttccatcattatcctatgggcatc
actgctgaaaatgttgctgagaagtatggtatcacccgtgagatgcaggatgaattctcc
gcaaacagccagcagaagtgccagaaggctcttgctgccggcaagttcaacgatgaaatc
gttccggtcgaagtcaagcagagaaagaagaccgttctgattgacaaggatgaagccccg
cgtgctggcattactgctgaaagcatttccggtttgaaaccttgcttcaaagagggcggc
actgttaccgctgctaactcctccggcatcaacgatgcagcttccgctgttgtcgtaatg
acagaagaaaaggccaaagagctgggcgtcaagccattggctttttggattgacggtgct
tctgctggtgttgatccggcttacatgggcttgggcccgatcgacgcaaccaagaaagtt
atgaaacacagtggcatgtccgtaaaggatatggacctcgtcgaagcaaacgaagcattt
gctgcacagtccatcgaagtctgccgcgaactgaacttcgatatggacaaggtcaacgtc
aacggcggcgctatcgcattgggccatccggttggctgctctggctgccgtatcttgaca
accctgatgtacgaaatgcagagaagacagagcgagtatggtctggctactctgtgtgtt
ggcggcggcatgggtgttgctacaatcgttaagagatacgaataa

DBGET integrated database retrieval system