KEGG   Ruminococcaceae bacterium CPB6: B6259_08180Help
Entry
B6259_08180       CDS       T04880                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
rbp  Ruminococcaceae bacterium CPB6
Pathway
rbp00520  Amino sugar and nucleotide sugar metabolism
rbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B6259_08180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rbp01005]
    B6259_08180
Enzymes [BR:rbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     B6259_08180
Lipopolysaccharide biosynthesis proteins [BR:rbp01005]
 Unusual sugar
  B6259_08180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ARP50844
UniProt: A0A1W6WFD4
Position
complement(1661714..1662289)
Genome map
AA seq 191 aa AA seqDB search
MSESCFVHPSACVDDGAQIGNGTKVWHFSHISGGARIGEDCTLGQNVFVADGVTIGSHCK
IQNNVSVYEGVQLGDYVFCGPSMVFTNVSRPRCRYPQRGAQFYKPTPIGDGTSIGANATI
VCGHTIGKNAFIAAGSVVTTDVPAHAIMMGVPARQHGWACECGAKLDEHLHCPKCGRQYA
EGKDGLHEVNG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtcttgctttgtccaccccagcgcctgtgttgatgacggcgcccagattgga
aacggtacaaaggtttggcacttttcccacatcagcggcggtgcccgcattggggaggat
tgcacactggggcagaacgtgtttgtggcggacggtgttaccatcggcagccactgcaaa
atccagaacaatgtcagcgtttatgagggcgtgcagctgggcgattacgttttctgcggg
ccgagcatggtctttaccaacgtgtcgcgcccgcggtgccgttacccgcagcgcggcgct
caattttacaagcccacacccattggcgacggcacttccattggtgcaaacgcaaccatt
gtgtgcggccacaccattggaaaaaatgcattcatcgccgccggcagcgtggtcacaacg
gacgtacccgcccatgccattatgatgggcgtgccggcacggcagcacggctgggcctgt
gagtgcggtgccaagctggacgagcatctgcactgccccaaatgcgggcggcagtacgcg
gaaggcaaagacggcctgcatgaggtgaatggctga

DBGET integrated database retrieval system