KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_01011Help
Entry
RHODOSMS8_01011   CDS       T05596                                 

Gene name
mcl
Definition
(GenBank) malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
rbs  Rhodobiaceae bacterium SMS8
Pathway
rbs00630  Glyoxylate and dicarboxylate metabolism
rbs00660  C5-Branched dibasic acid metabolism
rbs00680  Methane metabolism
rbs01100  Metabolic pathways
rbs01120  Microbial metabolism in diverse environments
rbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RHODOSMS8_01011 (mcl)
   00660 C5-Branched dibasic acid metabolism
    RHODOSMS8_01011 (mcl)
  09102 Energy metabolism
   00680 Methane metabolism
    RHODOSMS8_01011 (mcl)
Enzymes [BR:rbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     RHODOSMS8_01011 (mcl)
    4.1.3.25  (S)-citramalyl-CoA lyase
     RHODOSMS8_01011 (mcl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: AWZ00560
UniProt: A0A2Z4UI18
Position
1017017..1018060
Genome map
AA seq 347 aa AA seqDB search
MKLPASFYKPLSIGAPAPFQELPLALERMIHFFPAHNEKVHSKIPDLIPKVDVILGNLED
AIPADAKEAARAGFIKVAQENDFGNTGLWTRVNALNSPWALDDIVEIVSAVGDKLDVIML
PKVEGVWDIHYADQLLAQLEAKHGVKKPILIHAILETAQGVKNVNEIAAASPRMHGMSLG
PADLAASRGMKTTRVGGGHPSYGVIEDPKEDGSSRVFAQQDLWHYTVARMVDACLSNGIR
PFYGPFGDIQDTDACEVQFRNSFLLGCVGAWSLHPVQIDIAKKVFSPDVDEVKFALRILE
AMPDGTGAVMLDGKMQDDATWKQAKVIVDLAKRVAERDPELGKAYGL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcccagcttcattctataagcccctgtcaattggtgcgccggcacccttccaa
gagctgccattggcgctggaacgaatgatccacttcttcccagcgcataacgagaaggtt
cattctaaaattccagatctcattccgaaggtcgatgtgattcttgggaacctggaagac
gcaatacccgctgatgcaaaagaagcggctcgagctggtttcatcaaggttgcgcaggag
aatgactttgggaacacgggcctttggactcgggtcaatgcactgaacagcccttgggcg
ttggacgacattgttgagattgtcagcgccgttggcgacaagctcgacgtgattatgctg
cccaaagtggaaggtgtttgggacatccactacgcagaccaactgttggctcagcttgaa
gcaaaacatggcgttaaaaagcctatccttattcacgccatcctggagacagcgcaaggc
gtaaaaaatgtgaatgagattgcggcggcgagcccgcgcatgcatggcatgagcttgggt
cctgccgatcttgccgcatcacggggaatgaaaaccacgcgtgttggcggcggacatccg
tcctacggcgtgattgaagatccaaaagaagatggaagcagtcgggtctttgcgcagcag
gatctttggcactacacagttgctcgtatggtagacgcgtgcctctccaacggtattcgt
cccttctacggtccattcggcgatattcaggacacggatgcctgtgaagttcagttccgc
aactccttcctactcggatgcgttggcgcctggtcgttgcacccagtccagattgatatc
gcgaagaaagttttcagcccggatgtggacgaagtgaagttcgctctgcgcattctggaa
gccatgccggatggcacgggcgctgtaatgctcgatggcaagatgcaggacgatgcaacc
tggaaacaggctaaggtgatcgtcgatttggcgaaacgcgtcgcagaacgggatcctgag
cttggcaaagcttacggtctttaa

DBGET integrated database retrieval system