KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_02056Help
Entry
RHODOSMS8_02056   CDS       T05596                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rbs  Rhodobiaceae bacterium SMS8
Pathway
rbs00051  Fructose and mannose metabolism
rbs01100  Metabolic pathways
rbs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RHODOSMS8_02056 (fucA)
Enzymes [BR:rbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RHODOSMS8_02056 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AWZ01586
UniProt: A0A2Z4UL13
Position
complement(2068948..2069583)
Genome map
AA seq 211 aa AA seqDB search
MSALAQSVIDTALTMSTSGLSAGRSGNVSVRDGERVLITPTGMAYEDLVPSDIVSMGLDG
SVPPGSRKPSSEWHFHAAIYAAREDVNAIVHTHSNAATALACLEEGIPAFHYMVAAAGGA
DIRCAPYATFGTEELATFAVRALEDRTACLLSHHGVIACGSSLGKAYELAVEVETLADQY
GRARQLGSVPLLSDDEMQRVLDKFKGYGQRD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattggcacaatcggttattgatacggccttgaccatgtccacatccggcctg
tcggcaggtcggtcgggcaatgtgtctgttcgcgacggtgagcgtgttttgatcacccct
acaggcatggcgtatgaagaccttgtgccatcggacattgtgtccatggggctggatggg
tccgtgccgcccggctcccgaaagccgtcatcggaatggcattttcatgcagctatctat
gctgctagagaagacgtgaacgccattgttcatacccattctaatgcagctactgcgctt
gcgtgcctggaagaggggatacctgctttccactatatggttgcggcagcgggtggagcg
gatatcaggtgtgccccttatgcgaccttcggtacggaagaattggcaacctttgctgtg
cgggccctggaggatcgcaccgcttgtctgctctcacatcatggggtgattgcgtgcgga
tcgagccttgggaaagcctacgagctggctgtggaggtagaaacgcttgcagaccaatat
ggccgggcgcgtcagcttggttcggtgcccctgttgagtgatgacgagatgcagcgcgtg
cttgataagttcaagggttatggtcagcgggactga

DBGET integrated database retrieval system