KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_02277Help
Entry
RHODOSMS8_02277   CDS       T05596                                 

Gene name
mlhB
Definition
(GenBank) monoterpene epsilon-lactone hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rbs  Rhodobiaceae bacterium SMS8
Pathway
rbs00903  Limonene and pinene degradation
rbs00930  Caprolactam degradation
rbs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHODOSMS8_02277 (mlhB)
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RHODOSMS8_02277 (mlhB)
Enzymes [BR:rbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     RHODOSMS8_02277 (mlhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180
Motif
Other DBs
NCBI-ProteinID: AWZ01803
UniProt: A0A2Z4UL93
Position
complement(2281378..2282379)
Genome map
AA seq 333 aa AA seqDB search
MYEKAPSWRPQVNAASFRARFWIGLVQTVNKLLRKSVGAEGAEQKPFDVVTARKRVKFLE
NIIAMVPSNANFEEVTGAPVAGPWVCIEGAPQTRTLLYVHGGSFMLERSGVHDALIANIC
KEADATAFVLDYRLAPENPFPAGIEDVKTAYRWLLEEGTLPETLGVVADSAGGGLALAAL
IALRDEGVAMPGAMVLLGPWVDMTLSGNSILSNLENDPMVSSLEGLNMCSRLYLQGHSPT
DPLASPLFADLAGLPPTLIHVGAPEILRDDSTRLATRLREAGVDAWCDIYPRMPHVWHRL
GLLLPETKRSIKEIGDFLSEMLPGQREDKRRVG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagaaagcgcccagctggcgaccgcaggtgaatgcagccagctttcgcgcgcgt
ttctggattggtcttgttcagacggtcaataagctgcttagaaagtctgttggtgctgaa
ggtgcagaacagaaacccttcgatgtggtcaccgctcgtaagcgggtgaaatttcttgag
aacattattgccatggttccttcgaatgcgaattttgaagaagtgacaggcgctccggtt
gcaggaccttgggtgtgtattgagggtgcaccccagactcgcacgcttctctacgtccat
gggggctcgtttatgctggagcgttcaggtgttcatgacgcattgattgccaatatctgc
aaagaggccgacgcaacagcgttcgtgctggattatcgcctggcaccagaaaaccccttt
ccggcaggaattgaggatgtgaagactgcctatcgctggttgcttgaagagggcactctc
cctgagactctgggtgtggttgcggactcggccggcggtggcctggcacttgccgctctt
atcgcactccgcgatgaaggagtggcgatgccgggggccatggtgttgctcggtccctgg
gtagacatgacgctttcgggaaattcgattttgagcaatctggagaacgaccccatggtg
agttcgctggaagggctgaacatgtgctccaggctctatttgcaagggcactccccgacc
gatccgttggcgtcacctctgtttgctgatcttgctggtctaccaccgacgcttattcat
gtcggtgctccggaaattctacgggatgactccacgcggctcgcgacacgccttcgcgag
gccggggtggacgcgtggtgcgatatttatccgcgtatgccccatgtctggcatcgattg
gggcttttgctgccagagacaaaacgatcaatcaaagagattggtgactttctcagcgag
atgcttccgggacagcgcgaagacaaacggcgggtcggctag

DBGET integrated database retrieval system