KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_02398Help
Entry
RHODOSMS8_02398   CDS       T05596                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rbs  Rhodobiaceae bacterium SMS8
Pathway
rbs00260  Glycine, serine and threonine metabolism
rbs01100  Metabolic pathways
rbs01110  Biosynthesis of secondary metabolites
rbs01120  Microbial metabolism in diverse environments
rbs01130  Biosynthesis of antibiotics
rbs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHODOSMS8_02398 (ltaE)
Enzymes [BR:rbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RHODOSMS8_02398 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AWZ01922
UniProt: A0A2Z4ULT7
Position
complement(2422647..2423681)
Genome map
AA seq 344 aa AA seqDB search
MKFASDNGSGVALEIMSALGVANEGAAPGYGADEFTQEACERLSEIFERDVSAFLVATGT
AANALNLAAITQPHGAVFVHERAHVHTDECGAPEFYMHGAKLLPLGGEHGKLTPAAIEQG
LEGFTQGIVHHPQAQAISLSQVTESGTVYSVAEIEALSALAKKHSLRVHMDGARFANALV
SLGCSPAEMTWKAGVDVLSFGATKNGAMGVEAVIVFDEALSTNLPFMRKRAGQLLSKGRF
LGAQMSAYLKDDLWLGMAAHANEMAGHLAAGIDKLPGARLRHPVQANQVFAVLPKPAHKA
LLAAGAAYYPWEREPDGIAVRLVTSFSTSAEEVEQFLSIAGGAR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcgagtgataatggcagcggcgttgcgctggagattatgtctgcgctgggt
gttgcaaatgagggggcggctccgggatatggggcggatgagttcacgcaggaggcgtgt
gaacgcctctccgagatttttgagagagacgtatctgcctttttggtggcgactgggact
gccgccaatgcgctcaaccttgccgcgatcacgcagccacatggcgcagtctttgtgcat
gagcgcgctcatgttcatacagacgagtgtggagctccggagttctatatgcatggggcc
aaattgctgccgctcggcggagagcatgggaagctcactcctgcggcaatagagcagggc
ttggaagggtttactcaagggatcgttcatcatccgcaagctcaggcgatcagcctgtca
caggttacggagtcagggacggtttattcagtcgcggagattgaggcgctgtctgcgctg
gcaaagaagcactcactgcgtgtgcatatggatggtgcgcggtttgccaacgcgttggtg
tcactgggctgcagccccgctgagatgacctggaaggcgggcgtggatgtgctttctttt
ggtgcgacgaagaatggtgcgatgggcgtggaggctgtgatcgttttcgatgaagctctc
tccacaaacctccccttcatgcgcaagcgcgctggtcagctcctgtccaagggcaggttt
ctcggtgcccagatgagcgcttacctcaaagacgatctatggctgggcatggcggcgcat
gcaaacgagatggctgggcatctggctgcgggcatcgacaagctgccgggagcgcggctg
cggcatccagtgcaagcaaaccaggtgttcgccgttcttcccaagccagcacacaaagca
ctccttgctgcaggtgccgcctactacccatgggagcgggaaccagacgggattgctgtg
cgcctggtcacatcgttttccacttcagcggaggaagtggagcagtttctctctattgct
ggtggtgcccggtga

DBGET integrated database retrieval system