KEGG   Rickettsiales bacterium Ac37b: NOVO_01960Help
Entry
NOVO_01960        CDS       T03234                                 

Gene name
dadX
Definition
(GenBank) Alanine racemase, catabolic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rbt  Rickettsiales bacterium Ac37b
Pathway
rbt00473  D-Alanine metabolism
rbt01100  Metabolic pathways
rbt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NOVO_01960 (dadX)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    NOVO_01960 (dadX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbt01011]
    NOVO_01960 (dadX)
Enzymes [BR:rbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NOVO_01960 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rbt01011]
 Precursor biosynthesis
  Racemase
   NOVO_01960 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIL64787
UniProt: A0A077FHB9
Position
393120..394235
Genome map
AA seq 371 aa AA seqDB search
MTSYADAILNVDLNSIVYNYLFLKKKLNTVECGAVVKANAYGIGANHVASTLAKYGCKHF
FVANLEEAISLRAILTKQYNIYVLHGVFPNQEQEFIHYNLTPILNDIYQIKIWNCFASTK
KIQLPAILYIDTGLSRLGLTTYDALDLFYNQTLVANLNILYLMSHLSAADNPTHPLNAEQ
LKKMSIIQKYMPNTHITFVNSSGIFLGTNYHFHLARPGMALYGLNPTPQSKNPMHNVIYL
SSKIIQVRNNIKQSPVGYGGSYYAERNSVIATVAIGYADGYFRSLSNNSICYINGYKAPV
IGRVSMDLITLDVTNVPAHFIYPGQSVEIIGDNITVDQLAKYANTLGYEILTNLGHRFKL
VYNIDIQLNDI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgtatgctgatgccatattaaatgtagacttaaattctattgtctataattac
ctatttcttaaaaaaaaattaaatacggtagagtgcggagctgtagtaaaagcaaatgct
tacggcattggcgcaaaccatgttgcaagtacccttgctaaatatggctgtaagcatttt
tttgttgcaaatttagaagaagcaatttctttaagagcaattttaacaaagcaatataat
atttatgtattacatggtgtttttccaaaccaagagcaagaattcatacattataatctg
acacccattctaaatgatatatatcaaataaaaatctggaattgttttgcctccacaaaa
aagattcaacttcctgctatactttacattgataccggactttcacgccttggattaact
acatatgatgctctagatctattctataatcaaaccttggtggcaaatttaaatatatta
tatctcatgagccatttatctgctgctgataaccctactcatcctttaaatgcagaacaa
ttaaaaaaaatgtccattatacaaaaatatatgcccaatacgcatattacttttgtaaac
tcttctggtatttttttaggcaccaattatcatttccacctagcacgtcctggcatggca
ttatatggattaaatcctacacctcagtcaaaaaatcctatgcataatgtaatttatcta
tcttctaaaattatacaagtacgtaataatatcaaacaatctccagtaggatatggtggt
agttattatgctgaaagaaactcggtaatagcaactgtagcgattggttatgctgatggt
tatttcagatcacttagtaataatagtatatgctatattaacgggtacaaagcacccgtg
ataggacgtgtatctatggatttaattacgctagatgttacaaatgtaccagctcatttt
atatatccggggcaatctgtggaaattataggcgacaatataacagtggatcaactagca
aaatatgctaacaccttaggttatgaaatccttacaaatctagggcatagatttaaatta
gtatataatattgatatacagcttaacgatatataa

DBGET integrated database retrieval system