KEGG   Rickettsiales bacterium Ac37b: NOVO_02410Help
Entry
NOVO_02410        CDS       T03234                                 

Gene name
glpX
Definition
(GenBank) Fructose-1,6-bisphosphatase class 2
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
rbt  Rickettsiales bacterium Ac37b
Pathway
rbt00010  Glycolysis / Gluconeogenesis
rbt00030  Pentose phosphate pathway
rbt00051  Fructose and mannose metabolism
rbt00680  Methane metabolism
rbt01100  Metabolic pathways
rbt01110  Biosynthesis of secondary metabolites
rbt01120  Microbial metabolism in diverse environments
rbt01130  Biosynthesis of antibiotics
rbt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOVO_02410 (glpX)
   00030 Pentose phosphate pathway
    NOVO_02410 (glpX)
   00051 Fructose and mannose metabolism
    NOVO_02410 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    NOVO_02410 (glpX)
Enzymes [BR:rbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NOVO_02410 (glpX)
    3.1.3.37  sedoheptulose-bisphosphatase
     NOVO_02410 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AIL64876
UniProt: A0A077FNG7
Position
495231..496229
Genome map
AA seq 332 aa AA seqDB search
MASIKSSTVIQSNFAKGNHNLEQNLMFDILKVSIDGALASFDWVGKGDEKSADQAAVSAI
RSSLNQLNIDATIVIGEGERDKAPMLYIGEKVGIGSGPKLDIALDPLEGTTICAHAAPEA
MSVIAIAEEGGFLHAPDVYMEKIAIGPNFPPNIIDLDNTPHVNLQNIAKAKKCHVNDLTV
AVLKRERHKELIAKIREAGAKIQLISDGDIASVISTAISNSNVDIYMGTGGAPEGVLAAA
ALRATGGQMMGRLIFNDDNEKKRAYNMGISDPNQKYMIDDLAKGNVIFAATGVTSGSLLN
GIEKLSNHYTSHSMITYSKNSSIHYITSTHKF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctagcataaaatcatctactgtaattcaatctaattttgctaaaggaaatcataat
ttagaacaaaacttaatgtttgatatattaaaagtcagtattgatggggcactagcatct
tttgattgggttggcaaaggagatgaaaaaagcgcagatcaagcagctgttagtgctata
cgctcgtccttaaatcaacttaacatagacgctactattgtgataggagaaggcgaacga
gataaagcacctatgttatacataggagaaaaagtaggtataggttctggtcctaagcta
gatatagccttggatcctcttgaaggtactactatatgcgcacatgctgcaccggaagct
atgtcagttatagcaattgccgaagaaggaggatttttacacgctcctgatgtttatatg
gaaaaaatagctataggacccaatttcccccctaatataatagatttggataacacacct
cacgttaatttgcaaaatatagcaaaagctaaaaaatgccacgttaatgacttaacagta
gcagtcttaaagcgagaaagacataaagagcttatagctaaaattagagaggcaggcgct
aaaattcaacttattagtgatggcgatattgcaagtgtaatttctacagctattagcaat
tctaatgttgatatttacatgggaacaggtggtgctcccgaaggagttttagctgctgca
gcactacgcgcaactggaggacaaatgatgggtaggctaatatttaatgatgataacgaa
aaaaaacgtgcttataacatgggcataagcgatcctaatcaaaaatatatgattgatgat
ttagctaagggaaacgtaatatttgctgcaacaggtgtaactagcggctccctattaaat
ggtatagaaaaactatctaaccattacacatctcattctatgattacctattctaaaaat
tcgagtatacattacataacctctacgcataaattttaa

DBGET integrated database retrieval system