KEGG   Rickettsiales bacterium Ac37b: NOVO_05780Help
Entry
NOVO_05780        CDS       T03234                                 

Gene name
scoA
Definition
(GenBank) putative succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
rbt  Rickettsiales bacterium Ac37b
Pathway
rbt00072  Synthesis and degradation of ketone bodies
rbt00280  Valine, leucine and isoleucine degradation
rbt00650  Butanoate metabolism
rbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NOVO_05780 (scoA)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    NOVO_05780 (scoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOVO_05780 (scoA)
Enzymes [BR:rbt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     NOVO_05780 (scoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AIL65517
UniProt: A0A077FJ31
Position
1150795..1151493
Genome map
AA seq 232 aa AA seqDB search
MVTIYGDAKSALQGVLHDNITIMAGGFGLCGIPENLIFSIRDSGVKNLTIVSNNCGIDDF
GLGILLQTRQIKKMISSYVGENKTFEYQYLNGELELELNPQGTLAERIRAGGAGISAFYT
RTGVGTVVAEGKEHKDFDGKTYIMEKALIADLAIIKAWKADKAGNVIYRKTARNFNPIMA
TAAKVTIVEVEQIVEIGELDSDNIHTPSIFVHRLLQGANYEKRIERLVVNKH
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtggtaactatttatggtgatgcaaaatcagcattacaaggtgttttgcatgataatata
actattatggcgggagggtttggcctatgtggtattcctgaaaatttaattttttcgata
cgtgattcaggtgttaaaaaccttacaatagtaagtaataattgtggaatagatgatttt
ggtcttggtattttattacaaactaggcagataaaaaaaatgatttcttcttatgtggga
gaaaataaaacttttgaataccaatatttaaatggtgaattagaattggaactaaatcct
caaggtacgcttgcagaacgtattagagctggaggggcaggtatttcagctttttatact
aggacaggtgttggaacggtggtagcagaaggaaaagagcacaaagattttgatggaaaa
acatatattatggaaaaggcactcattgcagatttagcgattattaaggcatggaaagcg
gataaagctgggaatgttatatatcggaaaactgctaggaattttaatcctattatggca
acagctgctaaagtgacaattgtggaagttgaacagatagttgagattggtgaattggat
agtgataatattcatactcctagtatttttgtacatagattattgcaaggtgcaaattat
gaaaaacgtattgaacgtttagtagtaaataaacattag

DBGET integrated database retrieval system