KEGG   Rickettsiales bacterium Ac37b: NOVO_05870Help
Entry
NOVO_05870        CDS       T03234                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbt  Rickettsiales bacterium Ac37b
Pathway
rbt00071  Fatty acid degradation
rbt00072  Synthesis and degradation of ketone bodies
rbt00280  Valine, leucine and isoleucine degradation
rbt00310  Lysine degradation
rbt00362  Benzoate degradation
rbt00380  Tryptophan metabolism
rbt00620  Pyruvate metabolism
rbt00630  Glyoxylate and dicarboxylate metabolism
rbt00640  Propanoate metabolism
rbt00650  Butanoate metabolism
rbt00900  Terpenoid backbone biosynthesis
rbt01100  Metabolic pathways
rbt01110  Biosynthesis of secondary metabolites
rbt01120  Microbial metabolism in diverse environments
rbt01130  Biosynthesis of antibiotics
rbt01200  Carbon metabolism
rbt01212  Fatty acid metabolism
rbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOVO_05870 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    NOVO_05870 (phbA)
   00640 Propanoate metabolism
    NOVO_05870 (phbA)
   00650 Butanoate metabolism
    NOVO_05870 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NOVO_05870 (phbA)
   00072 Synthesis and degradation of ketone bodies
    NOVO_05870 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOVO_05870 (phbA)
   00310 Lysine degradation
    NOVO_05870 (phbA)
   00380 Tryptophan metabolism
    NOVO_05870 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NOVO_05870 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOVO_05870 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NOVO_05870 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbt04147]
    NOVO_05870 (phbA)
Enzymes [BR:rbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NOVO_05870 (phbA)
Exosome [BR:rbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NOVO_05870 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt 7TMR-HDED Phycoerythr_ab
Motif
Other DBs
NCBI-ProteinID: AIL65534
UniProt: A0A077FNI7
Position
complement(1169600..1170781)
Genome map
AA seq 393 aa AA seqDB search
MQTREVVIVDAVRTPIGNLNGAFISIAAHKLGEIVIRALLDRNNVDANMISEVMMGQVLT
GACGQNPARQASMNSGIPNNIPAFTINKVCGSGLKAVMLAAQSIMLGENDIVIAGGQESM
TMTSHAAYVRTGVRMGDTNLVDMMIKDGLIDAFNNYHMGITAENVAKKYDISRSKQDEFS
CNSQNKAESAQKSGKFVDEIIPVKIQSKKGEVIVEQDEFIKHGTTVEILSKLRPAFDKNG
TVTAGNASGINDGAAALLLMSAELAKKLGKKPLVSIKSWGKSGVDPAIMGIAPIYAVEKA
LKNASWQHTQLDLIEANEAFASQSIAIDQEIGWDITKVNVNGGAIALGHPIGASGARILV
TLLHEMKRRSVRKGIATLCIGGGMGVAMCVEAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaagagaagtagtgatagtagacgcagtacgtactcctattggtaatttaaat
ggagcttttattagtatagcggctcataagctaggagaaatagtgataagagcattacta
gatcggaataatgtagatgcaaatatgatttcagaagtaatgatgggacaagtattaaca
ggggcatgtgggcaaaatccagcccgtcaggcttcaatgaatagtggtatacccaataat
attccagcttttacaattaataaagtatgtggttctgggctgaaagcagtgatgcttgct
gctcagtctattatgttaggagaaaatgacatagtaatagcgggtggtcaagaaagtatg
actatgacctctcatgctgcatatgtgcgtactggtgtaagaatgggagatactaaccta
gttgatatgatgattaaagatggattaatagatgcgtttaataattatcatatgggtatt
acagcagaaaatgtagcaaaaaaatatgatatttcgcgtagcaagcaagatgaattctct
tgtaattctcaaaataaagctgaatctgcacaaaaatcaggaaagtttgtagatgaaatt
attcctgtaaagattcaaagtaaaaaaggtgaagttattgtagagcaggacgaatttata
aagcatggtactacagtagaaattttaagtaaattacgtccggcttttgataaaaatggt
acagttactgcagggaatgcttctggcattaatgatggtgctgcagccttacttttaatg
tctgcagagttggcaaaaaaattaggtaaaaaaccacttgtatctataaaatcttgggga
aaatcaggagtagatccggccattatgggtattgcgcctatttatgctgtggagaaagct
cttaagaatgctagttggcagcatactcagttagatttaatagaggcaaatgaggctttt
gcttctcaatcaattgcaattgatcaggaaatagggtgggatataactaaagtgaatgtt
aatggaggagctattgctttagggcatccaattggtgcatcgggtgcacgaatattggtt
acgttattacatgagatgaaaagaagatctgtgcgtaaaggtattgcaacactatgtata
ggtggggggatgggtgttgcaatgtgcgtagaggcaaaataa

DBGET integrated database retrieval system