KEGG   Rickettsiales bacterium Ac37b: NOVO_06130Help
Entry
NOVO_06130        CDS       T03234                                 

Gene name
rplV
Definition
(GenBank) Ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rbt  Rickettsiales bacterium Ac37b
Pathway
rbt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rbt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NOVO_06130 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rbt03011]
    NOVO_06130 (rplV)
Ribosome [BR:rbt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NOVO_06130 (rplV)
  Bacteria
    NOVO_06130 (rplV)
  Archaea
    NOVO_06130 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIL65580
UniProt: A0A077FM25
Position
1220480..1220857
Genome map
AA seq 125 aa AA seqDB search
MGKKAKPSKIANNEAIAKSTSLRVSPRKLGLIASFIQNMKVSEAVVQLTFVRKRIAGEVK
KCLQSAIANAENNHNLDIDKLYVYRAVVGKSVVMKRMHARARGRANRIHKYFSNLSIIVR
EYEEK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaagcaaaaccaagtaaaattgctaataatgaggctatagctaaatctact
tctttgcgtgttagcccaaggaaattagggcttattgcttctttcatacaaaatatgaaa
gtaagcgaggctgtagtgcaacttacgtttgtgaggaagcgtattgcaggagaagtaaaa
aagtgtttgcagtctgctatagcgaatgcggaaaataatcacaacttagacatagataaa
ttatatgtttatagagctgtagtaggtaaatctgttgtgatgaaaagaatgcatgctaga
gcaagaggtagggcgaatagaattcataaatattttagcaatttatctataattgtacgt
gaatatgaggagaaataa

DBGET integrated database retrieval system