KEGG   Rickettsiales bacterium Ac37b: NOVO_07130Help
Entry
NOVO_07130        CDS       T03234                                 

Gene name
rluD
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rbt  Rickettsiales bacterium Ac37b
Brite
KEGG Orthology (KO) [BR:rbt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rbt03009]
    NOVO_07130 (rluD)
Enzymes [BR:rbt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     NOVO_07130 (rluD)
Ribosome biogenesis [BR:rbt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NOVO_07130 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AIL65770
UniProt: A0A077FMM7
Position
complement(1423429..1424409)
Genome map
AA seq 326 aa AA seqDB search
MIINSTISLTPTASEQGLRVDKFIAERLKYLSRTRIKTLITSGYLTIDNCIIEDCNTSVK
LGSTYILTIPPPVETYIKPNESLKINIIYEDKFLLVINKQAGLTVHPGAGNHQDTLVNAL
LAYYGDSLSAIGGRLRPGIVHRLDKDTSGLMVVAKDDPTHHSLTKQLASRTLTRIYLAVV
FGVPKPLQGTITGNIGRHNQDRKKMSILKTGGKEAITNYSVQQIFYNNIASLIECKLVTG
RTHQIRVHFSHYGHSLIGDQTYGNNKRKLSKLFSEEIQEKIYNFNRQALHAISIGFIHPI
TKEHMQFTTELPDDLQNLVQILSDAK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgattattaattcaacaattagcttaacaccaacagcaagtgaacaagggctgcgagta
gataaatttatagcagagcgtcttaaatatctctcccgcactagaattaaaactttaata
actagcggctatttaaccattgataattgtatcatagaagattgtaacacatctgtcaaa
ttaggatctacatatatattaaccatacctcctcctgtagaaacctatataaagcctaat
gaatctttaaaaatcaacattatatatgaggataaatttttattagtcataaataaacaa
gcagggttaactgtccatcctggggctggtaaccatcaagataccttagtaaatgctcta
cttgcttattatggagatagtctatccgcaattggtggacgtttaagaccaggcattgtg
catagattagataaagatactagtggattaatggtagtagcaaaagatgatcctacccat
cactctttaaccaaacaattagcatcccgcacattaacaagaatatatctagctgtcgtt
tttggagtacccaaaccattacaaggcacaatcactggtaatataggtagacataatcaa
gatcgtaaaaaaatgagcattctaaagacaggaggcaaagaagcaattaccaactattca
gtacaacaaattttttataataatattgcctccttaatagaatgtaaactagtgaccggt
agaacccatcaaattcgggtacatttcagtcattatggtcattctctaataggtgaccaa
acatacggtaataataaacgtaaattatcaaaattattttccgaagaaatacaagaaaaa
atctacaattttaatagacaagcgctccacgctatatctataggatttattcaccccatt
accaaagaacatatgcaatttactacagaactaccagatgatttacaaaaccttgtacaa
atattatccgatgcaaaataa

DBGET integrated database retrieval system