KEGG   Rugosibacter aromaticivorans: PG1C_08125
Entry
PG1C_08125        CDS       T03689                                 

Definition
(GenBank) hypothetical protein
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00626  Naphthalene degradation
rbu01100  Metabolic pathways
rbu01120  Microbial metabolism in diverse environments
rbu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PG1C_08125
Enzymes [BR:rbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     PG1C_08125
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AJP48436
UniProt: A0A0C5JM22
Position
complement(1661819..1662793)
AA seq 324 aa
MLTKDDIRGISAMIPTPCKEGQGGWQYEDSVDLGETARMTELLISAGVGSIAANGTTGEC
AALTLEEKLAFTRTIVEVARGRVPVFAGITTLGTKETVRQMKKFRELGVQGGFVGLPLWQ
TPTITNSVQFYADLAEAVPDMGLMVYANPLFFKSTFPVEFWAGVGKHCPTVITCKYVGNL
FDPQNMLKDLPASMDAAPQVQFLPIDFAAPMAYNLVGDRLKGVWSTSCVMGPEPIVELQK
AIDAGDKARMGEIMHDLHSLPNAIPDFKDLAKYNVQVEKLRCNAAGYINAGPCRAPYQDI
PDDWRFATESSGKAWAELCKRKYR
NT seq 975 nt   +upstreamnt  +downstreamnt
atgttgaccaaagacgatatccgcggcatttctgccatgattccgacaccgtgcaaagaa
ggacagggcggctggcagtatgaggattcggtagatctgggtgaaaccgcgcgcatgacc
gagttgttgatctctgcgggcgttggctcgattgcggccaatggcactaccggcgaatgt
gccgcgctgacgctggaagaaaagctcgccttcacgcgcaccatcgtcgaggtcgcccgc
ggccgggtgcccgtgtttgctggcatcacgacgctcggcaccaaggaaacagtgcgccag
atgaagaaattccgcgaactgggcgtgcagggtggttttgtcggtttgccgctgtggcag
acgccgaccattaccaattccgtccagttctacgccgatctggccgaggccgtgccggat
atgggcctgatggtgtatgccaatccgctgttctttaaatccacctttccggtggagttc
tgggcgggcgttggcaagcattgtccgacggtgatcacttgcaaatacgtcggcaatctg
tttgatccgcagaacatgctcaaggatcttcccgccagcatggatgccgcgccgcaggtg
cagttcctgcccatcgatttcgctgcgcccatggcctacaacctggtgggtgaccgactc
aagggcgtgtggtcgaccagttgcgtgatggggccggagcccattgttgaattgcaaaag
gccatcgatgcgggcgacaaggcacgcatgggcgagatcatgcacgacctgcatagcctg
cccaatgccattccggacttcaaggatttggccaagtacaacgtgcaggttgaaaaactg
cgctgtaatgccgcgggttatatcaacgcgggtccgtgtcgcgcaccgtatcaggatatt
cccgacgattggcggttcgccaccgagtccagcggcaaagcctgggccgagctgtgcaag
cgcaaatatcgctga

DBGET integrated database retrieval system