KEGG   Rugosibacter aromaticivorans: PG1C_11305Help
Entry
PG1C_11305        CDS       T03689                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00071  Fatty acid degradation
rbu00072  Synthesis and degradation of ketone bodies
rbu00280  Valine, leucine and isoleucine degradation
rbu00310  Lysine degradation
rbu00362  Benzoate degradation
rbu00380  Tryptophan metabolism
rbu00620  Pyruvate metabolism
rbu00630  Glyoxylate and dicarboxylate metabolism
rbu00640  Propanoate metabolism
rbu00650  Butanoate metabolism
rbu00900  Terpenoid backbone biosynthesis
rbu01100  Metabolic pathways
rbu01110  Biosynthesis of secondary metabolites
rbu01120  Microbial metabolism in diverse environments
rbu01130  Biosynthesis of antibiotics
rbu01200  Carbon metabolism
rbu01212  Fatty acid metabolism
rbu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PG1C_11305
   00630 Glyoxylate and dicarboxylate metabolism
    PG1C_11305
   00640 Propanoate metabolism
    PG1C_11305
   00650 Butanoate metabolism
    PG1C_11305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PG1C_11305
   00072 Synthesis and degradation of ketone bodies
    PG1C_11305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PG1C_11305
   00310 Lysine degradation
    PG1C_11305
   00380 Tryptophan metabolism
    PG1C_11305
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PG1C_11305
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PG1C_11305
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PG1C_11305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbu04147]
    PG1C_11305
Enzymes [BR:rbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PG1C_11305
Exosome [BR:rbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PG1C_11305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJP48859
UniProt: A0A0C5JAU8
Position
complement(2316921..2318129)
Genome map
AA seq 402 aa AA seqDB search
MANAIVEKLANNDPVVILAAARTPIGSFQGKLAGFTAPELGAVAIREAVKRAGIASESVD
EVLFGTCLFAGQRQAPARQAALGGGLPGSAGCTTLTKMCGSAMKAVMLGHDVLLAGSSSM
VVAGGMESMSNAPYLLPRARTGYRLGHQKVLDHMLTDGLEDAIEGRLMGDFACSWAEQNT
FTREEQDRYATVSTQRAKLANTDGSFAWEIAPVTIKSRTGETVMDKDETPFAVNVEKIPT
LKPAFRPNGTITPANASSISDGAAALVLTLQSTAERLSLTPLARIIGHATHAADMASFPA
APIHAIRKLYAKTGWTTQDVDLFEVNEAFAVVALGAMRALDIPHEKMNVHGGACALGHPV
GSTGARIMVTLIGALRQRGLKRGIASLCIGGGEATAIAIELL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgcaatagtagaaaaattggcaaacaatgatccggtagtcatcctcgctgca
gcaagaacgccgattggttcttttcaaggcaaactcgctgggttcaccgcacctgagctg
ggtgccgtggcgattcgtgaggcagttaaacgcgcaggcattgcgtctgaatcggttgat
gaagtgctgttcggcacatgtttgtttgccggtcaaaggcaggcgccagcacggcaagcc
gcattaggtggcgggctgccaggttctgccgggtgcaccacgctgaccaaaatgtgtggc
tcagccatgaaagcagtcatgctcgggcacgatgttttgctggcaggcagttcaagcatg
gttgtcgcggggggaatggaatcaatgagcaacgcgccctacttgctgccacgtgcgcgt
acaggttatcgcttgggccatcagaaagtgcttgatcacatgctcaccgatggcttggaa
gatgccattgaaggacgactcatgggcgactttgcctgctcatgggctgagcaaaatacc
ttcacccgcgaggagcaagatcgctacgcaacggtgtcaacacaacgtgcaaagttggcc
aataccgacgggagttttgcctgggaaattgcacctgttacgattaaaagccggacaggc
gagacggtgatggacaaggatgaaacgccttttgctgtcaatgtcgaaaaaattcccaca
ttgaaaccggcgtttcgccccaatggcactattacgccagcgaatgcgagctcgatttct
gacggagctgcagcgcttgtgctgacactgcaatcaaccgctgagcgactgtctttgaca
ccgctagcccgcatcattggccatgcaacgcacgccgctgatatggcgtcttttcctgct
gcgcctattcatgccattagaaagctgtacgcaaaaacgggctggacaacgcaagacgtt
gatctgttcgaggtgaatgaagcgtttgctgtggtcgcactcggcgccatgcgggcattg
gatatcccgcatgaaaaaatgaacgtccatggcggcgcctgcgcgctgggtcatccggtg
ggatcgacgggtgcacgcatcatggtgacgctgattggcgcattgcgccagcgcggtctt
aagcggggtatcgccagtttatgtatcggcggcggcgaagcaacggccattgccattgag
cttttataa

DBGET integrated database retrieval system