KEGG   Rugosibacter aromaticivorans: PG1C_11600
Entry
PG1C_11600        CDS       T03689                                 

Definition
(GenBank) catalytic subunit of meta cleavage enzyme
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00621  Dioxin degradation
rbu01100  Metabolic pathways
rbu01120  Microbial metabolism in diverse environments
rbu01220  Degradation of aromatic compounds
Module
rbu_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PG1C_11600
Enzymes [BR:rbu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     PG1C_11600
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: AJP48897
UniProt: A0A0C5J1A4
Position
2372917..2373726
AA seq 269 aa
MGKIVAACGVSHILMSPMGCEGPAQNVVDGFQTLGRRLLAAQPDAVIIISSDHMFNIDLA
MQPRFVIGMSDHYTPMGDMDIPRTPITGHRALAEAIVKQADQDGFDLCQAEEYRLDHGVM
IPLLFMGLSHLPIVPLIVNINTHPMPSAQRCLILGETLRQAIETDLPAASRVAVIGAGGL
SHWLCVPRHGDVDEAFDHQVMDELCAGRHAALAQAGNADIIARGGNGGIEIMNWLMAAQA
ARSSGGEKIFYEPMRSWFTGLGGVLYHVT
NT seq 810 nt   +upstreamnt  +downstreamnt
atgggaaaaattgttgctgcctgcggcgtctcgcatatcctgatgtcccccatggggtgt
gaaggccccgcacaaaacgtcgttgacgggtttcagacgcttggccgccggttattggcc
gcgcagccggacgctgtgatcattatcagtagtgatcatatgttcaacattgacctggcc
atgcagccacgctttgtcattggcatgtcagatcactacacgccgatgggggatatggat
attccacgcacccccatcaccggccaccgtgccttggcggaggcaatcgtcaaacaagcc
gatcaggacggctttgatctttgccaagcggaagaataccgtctcgatcatggcgtcatg
attcccttgctgtttatgggcttatcccatttgcccatcgtgcccctgatcgtcaatatc
aatacgcatccgatgccctcagcacagcgctgcctgatactgggtgaaacactcaggcaa
gccatcgaaaccgatcttcctgcagcctcacgtgtggctgtaataggcgcaggcggtctt
tctcactggttgtgcgtgccgcgtcacggcgacgtggatgaagcgtttgatcatcaggtg
atggatgagctctgcgcgggacggcatgctgcactcgcccaggcgggcaatgccgacatc
attgcccgtggcggcaatggcggcattgaaattatgaattggctaatggcagcccaggca
gcccgttcttcaggcggtgagaaaatattttacgaaccaatgcgttcctggtttacaggc
ttgggcggcgtgctgtatcacgtcacctga

DBGET integrated database retrieval system