KEGG   Rhodococcus biphenylivorans: CEJ39_15020Help
Entry
CEJ39_15020       CDS       T05830                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby00480  Glutathione metabolism
rby00590  Arachidonic acid metabolism
rby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rby00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CEJ39_15020
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CEJ39_15020
Enzymes [BR:rby01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CEJ39_15020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AWZ25299
UniProt: A0A2Z4VKJ4
Position
3180309..3180842
Genome map
AA seq 177 aa AA seqDB search
MSVHEYTVATADGGSEDLARFAGRHLLIVNVASKCGLTPQYEALEALHRELGERGLQILA
FPCNQFGGQEPGSDSEIQEFCRVNFDVTFPVFAKVDVNGDDAHPLYRHLRAEAPGDFGPQ
HGFLFEHVSKTRPEAIGTDEVKWNFTKFLVDPQGAVVRRFEPTVTPEEIGKELTDLL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcacgagtacaccgtggccaccgccgacggcggcagcgaggatctcgcccgc
ttcgccggccggcatctgctgatcgtcaacgtcgccagcaagtgcggcctgaccccgcag
tacgaggccctcgaggcgctgcaccgcgagctgggcgagcgcggcctgcagatcctggcg
ttcccgtgcaaccagttcggtggtcaggaaccgggtagtgacagcgagatccaggagttc
tgccgcgtgaacttcgacgtcaccttcccggtgttcgcgaaggtcgatgtcaacggcgac
gacgcgcacccgctctaccggcacctgcgcgccgaggctcccggtgatttcgggccgcag
cacggtttcctgttcgagcacgtgagcaagacccgtccggaggcgatcggcaccgacgag
gtgaagtggaacttcaccaagttcctcgtcgacccgcagggtgcggtggtgcgccgcttc
gagccgacggtcacccccgaggagatcggcaaggaactcaccgacctgctctga

DBGET integrated database retrieval system