KEGG   Rhodococcus biphenylivorans: CEJ39_18595Help
Entry
CEJ39_18595       CDS       T05830                                 

Definition
(GenBank) GDP-mannose pyrophosphorylase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby00051  Fructose and mannose metabolism
rby00520  Amino sugar and nucleotide sugar metabolism
rby01100  Metabolic pathways
rby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CEJ39_18595
   00520 Amino sugar and nucleotide sugar metabolism
    CEJ39_18595
Enzymes [BR:rby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CEJ39_18595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954
Motif
Other DBs
NCBI-ProteinID: AWZ25901
UniProt: A0A2Z4VL57
Position
complement(3946834..3947919)
Genome map
AA seq 361 aa AA seqDB search
MTSESAPHTDAVILVGGQGTRLRPLTLSAPKPMLPTAGVPFLTHLLARIREAGIKHVVLG
TSFKAEVFEQHFADGSDFGLEIEYVTETEPLGTGGGIRNVLPRLRADNVMVFNGDVLGGT
DLGAVLDTHVRTEADVTLHLVRVSDPRAFGCVPTDEDGRVTAFLEKTQDPPTDQINAGCY
VFRREIIEQIPEGRPVSVEREVFPALLTEGKKVFGHVDAAYWRDMGTPEDFVRGSADLVR
GIAPSPALPPQRGESLVHPGASVAPGALLIGGTVVGRGAEIGAGARLDGAVIFDGARVEA
GAVVERSIIGFGVRVGPRALIRDGVIGDGADIGARCELLRGARVWPGVKIPDGGIRFSTD
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtgagtcggcaccgcacaccgatgcggtgattctggtcggcggacagggcacg
cggctacgcccgttgacgctgtcggcacccaagccgatgctgcccaccgcgggggtgcct
ttcctcacccatctgctcgcgcggatccgtgaggcaggcatcaaacacgtcgtcctcggc
acctcgttcaaggccgaggtcttcgagcagcacttcgccgacggttccgacttcggtctc
gagatcgagtacgtcaccgagaccgagccgctcggcaccggcggcggtatccgcaacgtg
ctgccgaggctgcgcgccgacaacgtgatggtcttcaacggcgacgtgctcggtggcacc
gatctcggtgcggtgctcgacacccacgtgcggaccgaggcggacgtgaccctgcacctg
gtgcgggtgagcgatccgcgtgccttcggctgtgtgccgaccgacgaggacggccgggtg
accgccttcctcgagaagactcaggatccgccgaccgatcagatcaacgccggttgctac
gtcttccgccgcgagatcatcgagcagatccccgaaggccgtccggtgtcggtggagcgc
gaggtgttcccggcgctgctgaccgagggcaagaaggtgttcgggcacgtcgacgcggcc
tattggcgcgacatgggcaccccggaggatttcgtccgcggctcggccgatctggtccgc
ggtatcgctccgtccccggcgctcccgccgcagcgcggcgagtcgctcgtgcatccgggt
gcctccgtggccccgggcgccctgctcatcgggggcacggtcgtcggccgcggcgccgag
atcggtgcgggtgcccgcctggacggcgcggtgatcttcgacggtgcgcgggtcgaggcc
ggtgcggtggtcgaacggagcatcatcggtttcggtgtacgggtcggtccgcgggccttg
atccgcgacggtgtgatcggtgacggcgccgatatcggtgcgcgatgcgagctgctgcgc
ggtgcccgggtgtggccgggagtgaagatccccgacggcggtatccggttcagtaccgac
gtgtga

DBGET integrated database retrieval system