KEGG   Rhodococcus biphenylivorans: CEJ39_18980Help
Entry
CEJ39_18980       CDS       T05830                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby00270  Cysteine and methionine metabolism
rby00920  Sulfur metabolism
rby01100  Metabolic pathways
rby01110  Biosynthesis of secondary metabolites
rby01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rby00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CEJ39_18980
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CEJ39_18980
Enzymes [BR:rby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CEJ39_18980
    2.3.1.46  homoserine O-succinyltransferase
     CEJ39_18980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AWZ25968
UniProt: A0A2Z4VLB1
Position
4023348..4024475
Genome map
AA seq 375 aa AA seqDB search
MTAGTERRRVELPPADGRLDTIDIGDLALESGETLPNVTVAVQRWGELSPARDNVVLVEH
ALTGDSHVTGPAGPDHPSPGWWSGMVGPGAPIDTDRWCVVSTNILGGCRGTTGPGSTAPD
GKAWGSRFPLITVRDQVAAEVALLDKLGIDVLAAVTGGSMGGMRTLEWIIAYPERVRASL
VLATGARATADQIGTQTAQMAAITADPDWQGGDYYGTGRRPEAGLAIARTIAHLTYRTEL
ELDTRFGNLPQDDEDPWRGGRYAVQSYLEHQARKLVARFDPGTYVVLSDVMNRHDVGRGR
GGVEAALASTPVPTIVAGVDSDRLYPLRLQQEIADLLPGSGDLRVLVSRDGHDGFLTEAD
EVAKLLVELMKLAEG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgacggcgggcaccgagcggcgtcgcgtcgaactgcccccggcagacggacgcctcgac
accatcgacatcggcgatctcgcgctcgagagcggcgagacgctgccgaacgtcaccgtc
gccgtgcagaggtggggcgaactgtcccccgcccgcgacaacgtggtgctcgtcgaacac
gccctcaccggcgactcgcacgtcaccggccccgccggaccggaccatccgtcccccggc
tggtggtcgggcatggtcggccccggtgctccgatcgacaccgaccgctggtgcgtggtt
tcgacgaacattctcggcgggtgccgcggcaccaccggccccggcagcaccgcacccgac
ggcaaggcctggggatcccgcttcccgctgatcaccgtgcgcgaccaggtggcggccgag
gtggcgctgctcgacaagctcggtatcgacgtcctcgccgccgtgaccggcggatcgatg
ggtggcatgcgcaccctcgagtggatcatcgcgtacccggagcgggtgcgagcgtcgctc
gtcctcgccaccggtgcccgcgcgaccgccgaccagatcggcacccagaccgcgcagatg
gctgccatcacggccgaccccgactggcagggcggcgactactacggcacggggcggcgt
cccgaagccggactcgccatcgcccggaccatcgcgcacctcacctaccggaccgaactc
gaactcgacacgcgcttcgggaatctaccccaggacgacgaggacccgtggcgcggcggc
cggtacgccgtgcagagctatctcgagcaccaggcgcgcaagctcgtcgcgcgtttcgat
cccggcacctacgtggtgttgtccgacgtgatgaaccggcacgacgtcgggcgcggacgc
ggcggcgtcgaggccgcactcgcgtccaccccggtcccgacgatcgtcgccggcgtcgac
tccgaccgcctgtacccgctgcgcctgcagcaggagatcgccgatctgctcccgggatcg
ggcgacctgcgtgtgctcgtctcccgcgacggacacgacggattcctcaccgaggccgac
gaggtcgcgaagctcctcgtcgaactgatgaagctcgccgagggctag

DBGET integrated database retrieval system