KEGG   Rhodococcus biphenylivorans: CEJ39_19470Help
Entry
CEJ39_19470       CDS       T05830                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rby00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CEJ39_19470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rby03011]
    CEJ39_19470
Ribosome [BR:rby03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CEJ39_19470
  Bacteria
    CEJ39_19470
  Archaea
    CEJ39_19470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWZ26055
UniProt: A0A2Z4VKX9
Position
complement(4117000..4117392)
Genome map
AA seq 130 aa AA seqDB search
MSTETTTNSARAVARHVRVTPMKARRVVDIVRGKSVEEALAILKFAPQAAAEPVAKVIAS
AAANAQNNYNLDPSTLVVATAYVDEGATLKRFQPRAQGRAFRIRKRSSHITVIVESVGSA
STRNRRKGAQ
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaccaccaccaacagcgctcgggctgttgcgcgccacgtgcgcgtgacc
ccgatgaaggcgcgccgcgtcgtcgacatcgttcgcggtaagtccgtcgaggaggccctg
gccatcctcaagttcgcgccgcaggccgcggccgagccggtcgccaaggtgatcgcgtcg
gccgctgcgaacgcgcagaacaactacaacctcgaccccagcacgctcgtcgtcgcgact
gcgtacgtggacgagggtgcgaccctgaagcggttccagccgcgtgcccagggccgtgcg
ttccgcatccgcaagcggtcgagccacatcaccgtgatcgtggaaagcgtcgggtcggcc
tcgactcgtaaccgccggaagggagctcagtag

DBGET integrated database retrieval system