KEGG   Rhodobacteraceae bacterium G7: B9057_01005Help
Entry
B9057_01005       CDS       T05514                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B9057_01005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rbz03011]
    B9057_01005
Ribosome [BR:rbz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B9057_01005
  Bacteria
    B9057_01005
  Archaea
    B9057_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUJ62991
UniProt: A0A2K9JJB6
Position
200279..200659
Genome map
AA seq 126 aa AA seqDB search
MGKAQNPRRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVEKALTDLTFSNKRIAVDVK
KCLQSAIANAENNHNLDVDELVVAEAYVGKNLTMKRGRPRARGRFGKIMKPFSELTIKVR
QIEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcacagaacccccgccgcgtggcagacaacgaagcaatggcaaaactgcgc
atgcttcgcactagcccgcagaaacttaacctcgtcgccgctatgatccgtggcaagaaa
gtcgagaaggctctgaccgacctgactttctcgaacaagcggattgctgtggacgtgaag
aaatgccttcagtccgcaattgcgaacgccgagaacaaccacaacctcgacgttgatgaa
ctggtcgtagccgaggcttatgttggcaaaaacctcaccatgaagcgcggtcgtccgcgt
gcacgtggtcgttttggcaagatcatgaagccgttttcggaactcaccatcaaggtgcgt
cagattgaggagcaagcctaa

DBGET integrated database retrieval system