KEGG   Rhodobacteraceae bacterium G7: B9057_01650Help
Entry
B9057_01650       CDS       T05514                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rbz  Rhodobacteraceae bacterium G7
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B9057_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AUJ63104
UniProt: A0A2K9JJ66
Position
complement(308225..309706)
Genome map
AA seq 493 aa AA seqDB search
MTSEDKSSWKTLDRDLNRISTLETATLYVSRPMIGFGLGLTFMVLAGFAAAFVFGLGSGS
AVVVAAAVFGAYMALNIGANDVANNMGPAVGANALTMGGAIVIAALCESAGALLAGGDVV
STISKGIIDPASFDSSMMFIWAMMAALVSSALWVNLATWIGAPVSTTHSVVGGVMGAGIA
AAGLATVNWTSMGQIAASWVISPVLGGAIAALFLWFIKTFIIYREDKIAAARRWVPVLIG
IMAGVFAVYLAVKGLKKLISIDLGPALLIGLAVGVATYLLSSPYIRKKSQGLENRNKSLK
VLFGLPLVISAALLSFAHGANDVANAVGPLAAIVHTQEFGEIAGKVHIPIWVMVIGALGI
SFGLVTFGPKLIRMVGSQITKLNPMRAYCVALSAAITVIVASWLGLPVSSTHIAVGGVFG
VGFYREWDHSRRARKLNLDMPEAKRLAPEERRRRKLVRRSHFMTIVAAWVITVPAAAGLS
AVVFYVLNGIFGS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagaagacaagtcgagctggaaaaccctcgatcgcgatcttaaccggatttcg
acgctcgaaacggcaacactgtatgtgtcgcgtcccatgatcggcttcgggctcggtctg
acctttatggtgctggctggctttgccgcggcattcgtgttcggcctaggctcaggttcg
gctgtggtcgtagctgctgcggtctttggcgcttacatggcgctcaacatcggggcgaac
gacgttgcgaacaacatggggcctgcggtgggcgcgaatgcgctgactatgggcggcgcg
attgtcatcgctgccctctgcgaaagcgctggcgctctgctggctggcggggatgttgtc
tcgacgatctcaaaggggattatcgatcctgcgagctttgacagctcgatgatgttcatc
tgggcgatgatggccgcgctggtgtcctcagcgctctgggtgaaccttgcgacttggatc
ggcgcgcctgtgtccacgacccactctgttgttggcggcgtaatgggcgctggtatcgcg
gcggcaggtctggccaccgtgaactggacgtcgatgggccaaatcgcggcgagctgggtg
atttcacctgtgctgggcggcgcgattgctgcgctgttcctgtggttcatcaaaaccttc
atcatctatcgtgaggacaaaatcgcagccgcacgccgttgggtgcctgtgctaatcggc
atcatggctggcgtctttgcggtttacctcgcggtgaagggcctgaaaaagctgatctcc
atcgacctcgggccggctctgctgatcggtctggctgtgggtgttgcgacataccttctg
tcgtcgccttacatccgcaagaaatcccaaggcttagagaaccgtaacaaatcgctcaag
gtgctgttcggtctgccgctggtcatctctgcggcgctgctgtcctttgcgcacggcgcg
aacgacgtggcgaacgctgttggtccgctggccgcaatcgttcacacccaagagttcggt
gaaatcgctggcaaagtgcacattccgatctgggttatggtgatcggtgcgttgggcatt
tcgttcggcctcgtcacctttggtcccaagctcatccgcatggttggctctcagatcacg
aaactgaacccgatgcgcgcatactgtgtggctctctctgctgcgatcaccgtgatcgtt
gcgagctggctgggtctgcctgtgtcgtcgacccacatcgcggttggtggtgtgttcggt
gtgggcttctatcgcgaatgggatcacagccgccgcgcgcgtaagctgaacctcgatatg
ccagaagcgaaacgcctcgcccccgaagagcgtcgccgccgcaaactggtgcgtcgtagc
cacttcatgaccatcgtcgcggcttgggtcattaccgtgcccgcagcggctggcctgtcg
gctgttgtgttctacgtgctcaacggaatctttggcagctaa

DBGET integrated database retrieval system