KEGG   Rhodobacteraceae bacterium G7: B9057_02155Help
Entry
B9057_02155       CDS       T05514                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00020  Citrate cycle (TCA cycle)
rbz00640  Propanoate metabolism
rbz00660  C5-Branched dibasic acid metabolism
rbz01100  Metabolic pathways
rbz01110  Biosynthesis of secondary metabolites
rbz01120  Microbial metabolism in diverse environments
rbz01130  Biosynthesis of antibiotics
rbz01200  Carbon metabolism
Module
rbz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B9057_02155
   00640 Propanoate metabolism
    B9057_02155
   00660 C5-Branched dibasic acid metabolism
    B9057_02155
Enzymes [BR:rbz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B9057_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AUJ63199
UniProt: A0A2K9JJG5
Position
complement(414037..414921)
Genome map
AA seq 294 aa AA seqDB search
MAILVNENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQEHLGLPVFDSVHEA
KAKTEANATVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALIDSKSRLI
GPNCPGIITPDACKIGIMPGHIHKRGSVGVVSRSGTLTYEAVKQTADIGLGQSTAVGIGG
DPIKGTEHIDVLDMFLDDPETQSIIMIGEIGGSAEEEAAAFLAEQRKKGRWKPTAGFIAG
RTAPPGRRMGHAGAIVAGGKGDAESKIEAMKSAGIIVADSPATLGEAVLKAIKG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccttgtaaacgaaaataccaaagtgatctgccagggcttcaccggctcgcag
ggcacgttccactcggaacaggcaatcgcatacggcaccaaaatggttggcggtgtgacc
cctggtaaaggcggtcaagagcacctcggcctgccagtttttgactcggttcacgaagcg
aaagcaaaaaccgaagcaaacgcgaccgtaatctacgttccgccgccattcgcagcagac
tcgatcctcgaagcgatcgacgctgaaatggaactgatcgtctgcatcaccgagggcatt
ccggtgctcgacatgatgaaggtaaagcgcgcgctgatcgactccaagtcgcgcctgatc
ggcccgaactgcccaggtatcatcacccctgacgcatgtaagatcggcattatgccgggc
cacatccacaagcgtggttcggttggcgttgtgtcccgttcgggcaccctgacttacgaa
gctgtgaaacagactgcggacatcggcctcggccagtcgaccgctgttggtatcggtggc
gacccgatcaaaggcacagagcacatcgacgtgctggacatgttccttgacgatccggaa
acccagtcgatcatcatgatcggtgaaatcggtggctctgcagaagaggaagcagcagca
ttcctcgctgaacagcgcaaaaaaggccgttggaaaccgaccgctggcttcatcgctggc
cgcacagcccctccgggccgtcgcatgggtcacgctggcgcaatcgtcgctggcggcaaa
ggtgacgcagagtccaagatcgaagctatgaagtcggcaggcatcatcgttgcagacagc
cctgcaaccctcggtgaagctgtgctgaaagcgatcaagggctaa

DBGET integrated database retrieval system