KEGG   Rhodobacteraceae bacterium G7: B9057_07990Help
Entry
B9057_07990       CDS       T05514                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00860  Porphyrin and chlorophyll metabolism
rbz01100  Metabolic pathways
rbz01110  Biosynthesis of secondary metabolites
rbz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B9057_07990
Enzymes [BR:rbz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     B9057_07990
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     B9057_07990
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     B9057_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: AUJ64244
UniProt: A0A2K9JM71
Position
1607203..1608603
Genome map
AA seq 466 aa AA seqDB search
MQHFPIFLSVTHRRIVLTGGGEAALAKLRLLLKTEGKITVFADAPHPDLLRMAAEGRLSL
VQRAFDYGDTLCARLVYAANEDAVEDARVARIARSEGAIVNIVDDLHGSDFITPAIVDRD
PVTIAIGTEGAAPVLARAIKADLEARLPSNLGLLARVGKAFRHAVDILPMGRKRRDFWAD
YYFNTGPKAVETDGEAGAQSALEATLDHHVMAKTRKGHVDLVGAGPGDPELLTLKARKAL
DEADVVIYDRLVAPEILELARREAIMVDVGKEGFGVSTSQDDINDLIVEHAKDGHHVVRL
KSGDPTVFGRLDEEIEAIEAAGISYRIVPGITAASAAVAQIGQSLTKRGRNGSVRLLTGH
DMKGFAEQDWRGLARDGEVAAIYMGKRAARFVQGRLLMHGASADTPVTIIENVSRPESRV
IATTLAELEPTMSTSGLTGPALTFYGLAPRHAVQVARSLPQKEAAQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactttccaatcttcctatcggtgacccaccgccgcatcgtcctgacaggtggt
ggcgaggcggcactggcgaaattgcgtctcttgctcaagactgagggcaagatcactgtt
ttcgcagatgccccgcatcctgaccttctgcgtatggcggctgagggtcgcctctcgctg
gttcagagggcgttcgattacggcgatacgctctgcgcacggttggtttatgcggcgaac
gaagatgcagtcgaagacgcccgtgtcgcacgtattgcccgcagcgagggtgcgatcgtt
aatatcgtggacgatttgcatggatcggactttatcacgcccgcgattgttgaccgtgat
cctgtaacgattgcaatcggcaccgagggcgcagcccctgttttggcgcgcgcgattaag
gcggaccttgaggcgcgtttgccatccaaccttggtcttttggcacgggtgggtaaggcg
ttccgtcatgcggtggacattctgccaatgggccgcaagcgtcgcgatttctgggcggac
tactatttcaacacgggccccaaggctgttgagacagacggtgaagctggtgcgcagtcg
gcgcttgaggccacgctcgatcatcatgtgatggcaaagacccgcaaaggtcatgttgac
ctcgttggcgcgggtccaggtgatccagaattactgactttgaaggctcgtaaagcgctg
gatgaggccgatgttgtaatctacgaccgtttggttgcgcctgaaatcctcgaactggcc
cgccgtgaggcgattatggtcgatgtgggtaaagagggtttcggtgtttcgacctctcag
gacgacattaacgatctgatcgttgagcatgcgaaagatggccaccatgttgtgcgcctc
aaatcgggtgatccaactgtctttggccgtttggacgaagaaatcgaagcgattgaggcg
gctgggatcagttaccgcatcgtgccgggcatcactgcggcctctgctgccgttgcgcaa
atcgggcagagcctgacgaaacgcggccgcaatggatcggttcgtctgctgacgggtcac
gatatgaaaggctttgccgagcaggactggcgtggtctagcccgcgacggtgaagtcgcc
gcgatctacatgggcaaacgcgctgcgcgtttcgttcagggccgtctgttgatgcacggc
gcgtcggctgacacgcctgtgaccatcatcgaaaatgtctctcgtcctgaaagccgagtg
atcgccacaaccttggccgagctagagccgacgatgtcgacctctggcctcactggccct
gccctcaccttttatggacttgcgccgcgtcacgcggttcaggtcgcccgctctctaccg
caaaaggaggccgcacaatga

DBGET integrated database retrieval system