KEGG   Rhodobacteraceae bacterium G7: B9057_12460Help
Entry
B9057_12460       CDS       T05514                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00790  Folate biosynthesis
rbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B9057_12460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbz04147]
    B9057_12460
Enzymes [BR:rbz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B9057_12460
Exosome [BR:rbz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B9057_12460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a IF-2
Motif
Other DBs
NCBI-ProteinID: AUJ65050
UniProt: A0A2K9JPF0
Position
2501153..2501419
Genome map
AA seq 88 aa AA seqDB search
MDITTLAAKGWTKTDDGTAIQKTFVFRNFVDAFGFMTRAAFWAEKWNHHPEWSNSYKTVA
VKLTTHDAGGLTEKDIKLAEKMEELEGR
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaccacccttgccgccaaaggctggacgaagaccgatgacggcactgcgatc
caaaaaactttcgtgtttcgcaactttgtcgatgcctttggtttcatgacccgcgccgct
ttttgggcggaaaagtggaatcatcaccccgaatggtctaactcttacaaaacggtggct
gtgaaactcaccacacatgatgccggcggtctgacggagaaggacatcaagctggccgaa
aaaatggaagaacttgaaggacgatga

DBGET integrated database retrieval system