KEGG   Rhodobacteraceae bacterium G7: B9057_13315Help
Entry
B9057_13315       CDS       T05514                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B9057_13315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rbz02022]
    B9057_13315
Two-component system [BR:rbz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   B9057_13315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AUJ65201
UniProt: A0A2K9JQ91
Position
complement(2663250..2663951)
Genome map
AA seq 233 aa AA seqDB search
MSADDAHILIVDDDERIRGLLQKFLMRNGFLVSTARDAAHARRILSGLEFDLIVLDVMMP
GEDGMSLCRDLRARLGTPIMLLTAKGETSDRIAGLEAGADDYLAKPFEPKELLLRINAIL
RRVPQAVPAVVVPKSLNMGPFRYDVDRGELWKGDDLIRLTATESQLMKIFSAKPSEPVSR
GTLVEELSRSGGQTQERAVDVQITRLRRKIEVDPKQPRYLQTVRGSGYMLQPD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgatgacgcccatattctaattgttgatgacgacgaacggatcaggggactt
ctacagaagttccttatgcggaatggttttttggtgagcaccgcacgcgatgcggctcat
gcgcgtcgtatcctgtctggtctcgaattcgatttgatcgttttggatgtcatgatgcct
ggcgaagacggcatgtcgttgtgccgtgatctgcgggcacggttgggcacgcccattatg
ttgctgaccgcaaagggtgagacctctgatcggattgctggtttggaagcgggcgctgac
gattacctagcaaagccgttcgagcccaaagaactgttgttgcggatcaatgcaatcctg
cgccgtgttccgcaggcggttcctgctgtcgtggtgccgaagtcgcttaatatgggtccg
tttcgctacgatgtggatcggggggagttgtggaagggtgatgatctgatccgcctgacc
gcgaccgagagtcagttgatgaagatcttcagcgctaagcccagtgaacccgtatcgcgg
ggcaccttggttgaagagcttagccgttctggtgggcaaacgcaggaacgcgcggtcgat
gttcagatcacccgtctacgccgcaagatcgaggtcgatccgaagcagcctcgttatcta
cagacggttcgcggttctggctacatgttgcagcctgattga

DBGET integrated database retrieval system