KEGG   Rhodobacteraceae bacterium G7: B9057_15755Help
Entry
B9057_15755       CDS       T05514                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00040  Pentose and glucuronate interconversions
rbz00053  Ascorbate and aldarate metabolism
rbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B9057_15755
   00053 Ascorbate and aldarate metabolism
    B9057_15755
Enzymes [BR:rbz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     B9057_15755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUJ65859
UniProt: A0A2K9JRT8
Position
unnamed2:complement(213448..214962)
Genome map
AA seq 504 aa AA seqDB search
MTFTPHGKHLIAGQWIGSDSTFTSEPAHGPAHAFSIGTPQLIDQAAKAAEDAFWTYGYST
REERAAFLNAIADEIEARAEAITEIGSQETGLPEARLQGEHGRTVGQLRLFAQHILDGAY
LDRRYDAAQPDRQPLPRPDIRMMQRPIGPVAVFGASNFPLAFSTAGGDTASALAAGCPVV
VKGHSAHPGTGEIIAEAVHAAIAKCGIHHGVFSLIQGGKRDVGQSLVEHPLIKAVGFTGS
LAGGRALFDLCARRPEPIPFFGELGSVNPMFFMPAALANRGAAIAAGWAGSLTMGAGQFC
TNPGIAVVIDGPDADNFISAATEALAPMGAQTMLTDGIAAAYRAGRDQIAGTKGVQELLT
SMCDQRNATPYLFATTGKEWLENEILGEEVFGPLGLVVRVADIDEMHKIARHLQGQLTCT
IHMDDADVADACALLPILERKAGRILANGFPTGVEVCDAMVHGGPYPASTNFGATSVGTM
AIRRFLRPVCYQNIPEAVLPSDLS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacctttacaccccacgggaaacacctaatcgctggtcaatggatcggttctgatagc
acatttacctcagaacccgcccacggccccgcccacgcttttagcattggcacgccgcaa
ctcattgatcaggccgcgaaagcagccgaagacgcattttggacttatgggtattcaaca
cgtgaagagcgtgctgcatttctaaacgccattgccgacgaaattgaggcccgcgctgag
gcaatcaccgaaattggcagccaagaaacgggcctccccgaagcgcgccttcaaggggaa
cacggacgaacagttggccagctgcgcctttttgcacaacatatcctcgacggtgcatac
cttgatcgccgctatgatgcggcccaacctgatcgccaacctttgccccgtcctgacatt
cgcatgatgcaacgtccgatcgggcccgttgccgtattcggcgcttcgaacttcccgctc
gcattttcgacagcgggcggcgatactgcatcggcactcgcggctggctgccccgttgtg
gtaaaaggccattctgcccacccaggcactggtgaaatcatcgcagaggcagtgcacgca
gccatcgcgaaatgtggcattcaccatggggtatttagtctgatccaaggcggaaagcgc
gacgttggccaatccctcgtcgagcatccgctgatcaaagctgttggctttacgggttcg
ttggctggtggtcgcgccctgtttgatctttgtgcacgacgccccgagcccattccgttc
ttcggtgaattgggcagtgtgaaccctatgttctttatgcccgcagcccttgcaaaccgc
ggtgctgcgatcgcggcgggttgggctgggtcgctcaccatgggcgcggggcaattctgt
acaaatccaggcattgcggtcgtcattgatgggcctgatgcggataactttatttctgct
gcaacagaagcgcttgcaccaatgggcgctcagaccatgttgaccgacggcatcgccgct
gcatatcgcgcaggccgcgatcagatcgctggaaccaagggtgtccaagagctgctgacc
tctatgtgtgaccagcgcaacgccactccgtatttgttcgccacaacaggtaaagaatgg
ttagagaacgaaatccttggcgaagaagttttcggaccgctgggtctagtcgttcgcgtc
gcagatatagacgaaatgcataaaattgcacgtcacttgcaggggcagttgacctgcacc
atccacatggacgacgctgacgttgcagatgcttgtgccttgctcccgattttggagcgc
aaggctggacgtatcctcgcgaatgggttcccaacaggcgtcgaagtttgcgatgcaatg
gtccacggcggaccctaccctgcctcgaccaatttcggggcaacatcggtcggcacgatg
gccattcgccggttcttgcgccccgtgtgctaccagaacatccccgaagccgtgcttcca
tctgatctgtcctaa

DBGET integrated database retrieval system