KEGG   Roseiflexus castenholzii: Rcas_0301Help
Entry
Rcas_0301         CDS       T00585                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00790  Folate biosynthesis
rca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rcas_0301
Enzymes [BR:rca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rcas_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EAL
Motif
Other DBs
NCBI-ProteinID: ABU56434
UniProt: A7NG47
Position
376114..376791
Genome map
AA seq 225 aa AA seqDB search
MTYHNGNNGHHDHALADVDEREYETLIIQGRGKLEGMSYHSDAAIEDAVRVILKQIGENP
EREGLQKTPSRVAKMYAELTAGYHIDPDALINEAVFSVGYDEMVLVKNIEFSSLCEHHML
PFMGRVHVAYIPNGRVVGLSKIPRIVEMFARRLQVQERMTVQIADFINQRLEPLGVAVVA
EGVHMCAVMRGVKKAGATMVTSAMRGVFRDDPKTRSEFMAHIERG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcacaatggcaacaatggacaccacgaccatgcgctcgcagacgtggacgag
cgcgaatacgaaaccctgatcatccagggacgcggcaaacttgaaggaatgagttatcat
tccgacgcagcgattgaagacgccgtgcgagtcattctgaagcagatcggcgaaaatcct
gaacgtgaggggttgcagaagacgccgtcgcgcgtcgccaaaatgtacgcggaactgact
gccgggtaccatattgatcccgacgcgctgatcaacgaagcggtcttcagcgtcggctac
gatgaaatggtgctggtcaagaatatcgagttctctagtctgtgcgagcaccatatgctt
ccttttatggggcgggtgcacgtcgcgtacattcccaacggcagagtcgtggggttgagc
aagattccgcgcattgtcgagatgttcgcgcggcgcttgcaggtgcaggaacggatgaca
gtacagatcgccgattttatcaatcagcggctcgaaccactgggcgtggcggtcgtcgcc
gagggcgttcatatgtgtgcagtgatgcgcggtgtcaagaaagccggcgccaccatggtc
acatccgcgatgcgcggggtcttccgcgatgatccgaagacacgcagtgagttcatggcg
catatcgagcggggatga

DBGET integrated database retrieval system