KEGG   Roseiflexus castenholzii: Rcas_0522Help
Entry
Rcas_0522         CDS       T00585                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00670  One carbon pool by folate
rca00720  Carbon fixation pathways in prokaryotes
rca01100  Metabolic pathways
rca01120  Microbial metabolism in diverse environments
rca01200  Carbon metabolism
Module
rca_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Rcas_0522
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rcas_0522
Enzymes [BR:rca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Rcas_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ABU56652
UniProt: A7NGQ9
Position
complement(681744..683438)
Genome map
AA seq 564 aa AA seqDB search
MRSDLDIAQAARLRPIRAVAADLGLTDDDIELYGRSIAKIDLGILQRLTDQPRGRYIVVT
AITPTPLGEGKTTTTIGLGQALARLGKRSVVTIRQPSMGPTFGIKGGAAGGGYSQVLPME
QFNLHLTGDIHAIGAAHNLLAAMIDNHLHHGNQCGIDPYAIFWSRVVDISDRVLRNVVVG
LGKKEDGPMRQTQFDITVASEVMAILALTTNLHDLRQRLGRIVAAYTRDGAPVTAEDLHA
AGAMTVLLKEAIKPNLLQTLEGSPALVHCGPFANIAHGASSVLADMIGLHCADYVVTESG
FGADIGFEKFCDIKCRASGLAPDAVVLVATVRALKAHSGRYTITAGRPLDPRLAEENPED
VADGAANLAAQVRIARLFGRPVVVAINRFPDDFPSEVEVIRQVARESGAFDVVESFVFAE
GGAGGCDLARAAIQACEAPGTFTPLYPLDMSLREKIETLATKVYGATRVEYTPEASRRLA
QFEHQGYGNLPICMAKTHLSISHDPKLRGAPSGYVFPIRDVRLAAGAGFIYPLAGDIRTM
PGLPAHPAAERIDIDAEGRTRGLS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgatctcgacatcgctcaggcggcgcgccttcgcccgattcgcgccgtcgcc
gccgaccttgggctaaccgacgatgatatcgaactgtacggtcgcagtatcgccaaaatc
gatctgggcatcctccagcggttgaccgatcaaccgcgcggtcgctacattgtcgtcacc
gcgatcacccccacgccgctgggtgaaggcaaaaccaccaccaccatcggcctggggcag
gcgctggcgcgcctggggaaacgttccgtcgttaccatccgccaaccttcaatgggaccg
accttcggcatcaaggggggcgcggctggcggcgggtatagccaggtgttgccgatggag
cagttcaacctgcatctgaccggcgacattcacgcaattggcgcagcgcacaacctgctt
gccgccatgatcgacaatcacctgcatcacggcaatcagtgcggcatcgatccgtatgca
attttctggtcccgcgtggtggacattagcgaccgcgtgctgcgcaatgttgtggtgggg
ttgggaaagaaagaagatggaccgatgcgccagacgcagttcgacatcacggttgcctcg
gaagtgatggcgatcctcgcgctgacgacaaatctgcacgacctgcgacagcgattgggg
cgcattgtggcggcgtacacgcgcgatggcgcgccggtgaccgccgaggatctgcatgcc
gcaggcgctatgaccgtcttgctcaaggaagccatcaaaccgaacctgttgcagacgctc
gaaggatcgccggcgctggtccattgcggaccgttcgccaacattgcgcacggcgcctca
tcggtgctggcggacatgatcgggttgcactgcgccgattacgtggtcaccgaaagcggg
ttcggcgctgacatcggcttcgagaagttttgcgacatcaaatgtcgcgcctctggtctg
gcgccggatgcggttgtgctggtagcaacggtgcgggcgctcaaggcgcacagtgggcgc
tacaccatcaccgccggcagaccgctcgatccacggcttgccgaggagaacccggaggat
gttgcggatggagcagcgaacctggcggctcaggtgcgcatcgcgcgcctcttcggtcga
ccggtggttgtggcgatcaaccgcttccccgacgattttccatcggaagttgaggtgata
cggcaggtcgcgcgcgaatcaggagcgttcgatgtggtcgaaagttttgtcttcgccgaa
ggcggcgcaggcggttgcgatctggcaagagcggcgatacaggcgtgtgaagcgcctggg
acgtttaccccactctacccgctcgatatgagtctgcgcgagaagatcgaaacactggca
acgaaggtgtatggggctacgcgggtggagtacacccctgaagcctcacggcgactggcg
cagttcgaacatcaggggtacggcaacctgccgatctgcatggcaaaaacgcatttatcg
atcagccacgacccgaaactgcgcggcgcgccttcggggtatgtcttcccgatccgcgac
gtgcgcctggcagccggggcgggcttcatctatccgctggcaggcgacattcgcacgatg
ccggggttgccagcccatcctgccgctgagcggatcgacatcgatgccgaaggaagaacg
agagggttgtcgtag

DBGET integrated database retrieval system