KEGG   Roseiflexus castenholzii: Rcas_0678Help
Entry
Rcas_0678         CDS       T00585                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00010  Glycolysis / Gluconeogenesis
rca00052  Galactose metabolism
rca00500  Starch and sucrose metabolism
rca00520  Amino sugar and nucleotide sugar metabolism
rca00521  Streptomycin biosynthesis
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rcas_0678
   00052 Galactose metabolism
    Rcas_0678
   00500 Starch and sucrose metabolism
    Rcas_0678
   00520 Amino sugar and nucleotide sugar metabolism
    Rcas_0678
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rcas_0678
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rcas_0678
Enzymes [BR:rca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rcas_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABU56802
UniProt: A7NH55
Position
complement(886321..887295)
Genome map
AA seq 324 aa AA seqDB search
MLDPTPLIQERLSQNRWGLLGGQGCVLGFDVGSYGLRAALVDLSRHTYVSAHREPERETP
QELVGGAIDLGNEILTMHGVTSAHLVRVGAGFGGPVDVRQGIVLLSPRMSGWERYPLREA
FENAFGATCLVDNDANLIALAEATFGVGRDTQHMVYIHLSTGVGAGLVLDGRLYHGATTT
AGEIGHAVVGPVDPTRPGERPKTLEEHVSIKGLLNRAAELGLHTNLLSDIFSDHPAAQQV
VAEAIDILAVRIAQIVALIDPQMVVIGGVVARNGGDMFINAIRERMHMYIGQMVERPVQV
VGAVLGPDSVAIGAVALALESMRD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatccgacgccgctcatccaggagcgattatcacagaaccgctgggggttgctc
ggcggtcaagggtgcgttctcggattcgatgtcggcagttatggattgcgagcggcgctg
gtagatctgagtcgtcacacctatgtcagcgcacaccgtgagccagagcgtgagacgcca
caagaactcgtgggaggtgcgattgatctggggaatgagatcttgacgatgcatggcgtc
acatccgcccacctggtccgtgtcggagcaggattcggcggaccggtggatgtgcgtcag
gggattgtcttgctgtcgccgcgcatgtccgggtgggaacgctatccgctgcgagaagca
ttcgagaatgcgttcggcgcaacgtgcctggtcgataacgatgccaatctcatcgctctg
gcagaagcgacttttggggtaggacgcgacacgcaacacatggtctacattcacctgagc
actggtgttggcgctggtctcgtgctcgatgggcgcctgtaccatggcgccaccacaaca
gcgggtgagattgggcacgcggtggtcggtccggtcgatccaacgcgacccggtgagcga
cccaaaaccctggaagagcacgtatcgatcaaagggttgctgaatcgcgcagcagaactt
ggactgcacacgaacctgctgagcgatattttcagcgatcatcccgcagcacaacaggta
gtcgccgaagccatcgacattctggcagtgcggatcgcgcagatcgtcgccctcatcgac
ccccagatggtcgtcatcggcggagttgttgcgcgcaacggcggcgacatgtttatcaac
gccattcgggaacgtatgcacatgtatattgggcagatggtcgagcgcccggtgcaggtg
gttggcgctgtgctcggtcccgatagcgttgcgattggcgcggtggcgctggcgctcgaa
agcatgcgcgactga

DBGET integrated database retrieval system