KEGG   Roseiflexus castenholzii: Rcas_2363Help
Entry
Rcas_2363         CDS       T00585                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
rca  Roseiflexus castenholzii
Pathway
rca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rca00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rcas_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DHOR Rota_Capsid_VP6
Motif
Other DBs
NCBI-ProteinID: ABU58445
UniProt: A7NLP9
Position
3049633..3050049
Genome map
AA seq 138 aa AA seqDB search
MQPLIRMTIGVALVLGALLLAANTLGRPPAAPASGPIAGDATRGQIVFERAGCSACHTTT
TEFRVGTGMAGVLQPEGPVYPPGVNYGGLLPNGAPRTEENVAAFIRATNQGQIGIMPGRA
LSDQQMADLIAYLRTLTR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccattgattcggatgaccatcggagttgccctggtgctcggcgcgctgctgctg
gcggcgaatacgctcggcagacctcccgccgcgcccgcgagcggaccgattgccggtgat
gcaacgcgcgggcagattgtcttcgagcgcgccgggtgcagcgcctgccatacgacgacc
accgaatttcgggttggaacggggatggcaggcgtgctgcaaccggaaggaccggtctat
ccgccgggggtgaactatggcggtttgctgcccaacggcgcgccgcgcactgaagagaac
gtcgccgccttcattcgcgcgaccaaccagggacagatcggcatcatgcccggacgcgcc
ctgagtgaccagcagatggctgatttaatcgcctatctgcgcacgctgacgcgctaa

DBGET integrated database retrieval system