KEGG   Roseiflexus castenholzii: Rcas_2631Help
Entry
Rcas_2631         CDS       T00585                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
rca  Roseiflexus castenholzii
Pathway
rca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rca00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rcas_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABU58704
UniProt: A7NME2
Position
complement(3392752..3393195)
Genome map
AA seq 147 aa AA seqDB search
MNRTYTITFACLLTLTLALSACGGGQGAPAANAPVEPLTRTISANGDPAKGQLYFENEGG
CLACHSTGTDKLVGPGLAGVMTTAGPVYPEGVNYRGNLPNGQPRTEENIAAWIRSGGQGQ
IGVMSPHEMSDEDMANLLAYLHTLKRP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcacgtatacgataaccttcgcctgcctgctcacattgacgctggcgctgtcc
gcatgcggcggcgggcagggcgctcccgcagcaaatgcgccggtagagccgctgacgcgc
acgatctctgccaatggcgatcccgccaaggggcaactctacttcgagaacgagggtgga
tgcctggcgtgccactcgaccggcaccgataaacttgtgggtccggggctggccggtgtg
atgacaacggcgggtccggtctatcccgaaggggtcaactaccgcggcaatctgcccaac
ggacagccgcgcaccgaagaaaacatcgccgcctggattcgcagcggtggtcaggggcag
atcggcgtaatgtcgccacacgaaatgagcgatgaagatatggccaatctgttagcgtat
ttgcacacgctgaagcgaccgtag

DBGET integrated database retrieval system