KEGG   Roseiflexus castenholzii: Rcas_2852Help
Entry
Rcas_2852         CDS       T00585                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00220  Arginine biosynthesis
rca00330  Arginine and proline metabolism
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01130  Biosynthesis of antibiotics
rca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rcas_2852
   00330 Arginine and proline metabolism
    Rcas_2852
Enzymes [BR:rca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rcas_2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABU58922
UniProt: A7NMZ3
Position
3702157..3703170
Genome map
AA seq 337 aa AA seqDB search
MTPTTTTSTLTMVLPDMVALPHFAHPTINPPVRHPAAVTVIIERDDMKTHPLTALQVIGV
RYRGSTPAENDERALDAYAASGVYHAASVPTTISEPRMPATQRRIDEPSNLGWICRAIAD
DVAAAHARGRAPLIVGGDCTHAVGVVAGLQRSHGPNARIGLVWFDAHGDYNTPRTTLSGM
LGGMPVAVCAGLALPQWRDLAGMQAPLPTDRIMLVDARNLDPPEEQLIRATETAIADVND
FAGPLASLAAACDVLYLHVDSDILEAALVPNHATREPDGPGLSEVSAAIDTVMATGKVGA
FAVVSVYGAGPGSDISVASGTALIRAGLEAWARHGTV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgacgacgacaacgtcaacgttgaccatggtcctgcccgatatggtcgccctg
ccccatttcgcacacccgacgatcaacccgccggtgcgtcacccggcggcggtgacggtc
atcatcgagagagacgatatgaaaacccatccattaaccgcccttcaggtcatcggcgtg
cgctatcgcggcagcacacctgccgaaaacgacgagcgcgcgctcgacgcttatgctgcc
tccggcgtctaccacgccgccagtgtgccgacgacgatcagcgaaccacggatgccggca
acacagcgtcgcattgacgaaccatcgaacctgggttggatctgtcgcgctatcgccgat
gatgttgccgcggcgcacgcgcgtgggcgcgcgccgctgatcgtcggcggcgactgcacc
cacgccgttggcgtcgtcgccgggctgcaacgctcccacggaccgaatgcgcgcatcggg
ttggtctggttcgatgcgcacggcgactacaacacgccacgcacaaccctctccgggatg
ctgggcggtatgccggtggcagtgtgcgccggactggcgctgccgcagtggcgcgaccta
gcggggatgcaggcgccattgccgaccgaccgcatcatgctggtcgatgcgcgtaacctc
gacccgcccgaagagcagttgatccgcgccaccgaaaccgctatcgccgatgtcaacgat
ttcgccggtcctctggcatcgctcgcggctgcttgcgacgtgctctacctgcacgttgac
tccgacattctcgaggctgcgctcgtgccgaaccacgccacccgcgaaccagacggaccg
gggctgtccgaggtaagcgcggccatcgacacggtcatggcgaccggcaaggttggcgcg
tttgcggttgtttcggtgtacggcgccggtcccggtagcgacatcagcgtcgcatcggga
acagcgctcattcgcgctggattggaagcctgggcgcgacatgggacggtgtag

DBGET integrated database retrieval system