KEGG   Roseiflexus castenholzii: Rcas_3006Help
Entry
Rcas_3006         CDS       T00585                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00670  One carbon pool by folate
rca00720  Carbon fixation pathways in prokaryotes
rca01100  Metabolic pathways
rca01120  Microbial metabolism in diverse environments
rca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Rcas_3006
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rcas_3006
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Rcas_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Sensor_TM1
Motif
Other DBs
NCBI-ProteinID: ABU59063
UniProt: A7NND0
Position
complement(3902372..3903301)
Genome map
AA seq 309 aa AA seqDB search
MRSFSEFQRRLQAGQIVVTGEIAPPRGASRATVERLALGLRDAVDAINLTDNQRGLGRMS
ALGAGIIIRQLGLEPIVQMTCQHRNRIALQADVLSGAACGITNFLAMTGDHPKIGDHPDA
KNVLDLNSFQLLKMLRTMRDEGKFQSGVALTEPPRFFLGGVANPNIERVARLERKIQFGA
EFIQTQILFDLDRFRQWMADARAAGLHQKAYILAGIMVVKSAQSARFLRDHLPGSRVPEW
VIERMERADHPEEEGIAIAAELTRELLAIEGVRGVHVMSVGWTKAIPQVVERAGLLPRPP
LPPDNPNDD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtttcagcgaatttcagcgacggctccaggcagggcagatcgttgtcaccggt
gagattgcaccgccacgcggtgcatcccgtgcgacggtcgaacgactggcgcttggtctg
cgtgatgccgtagatgcaatcaatctgacggataaccagcgcgggctggggcgcatgtcg
gcgctcggcgccggtattattattcgtcaactcgggttggagccgattgtccagatgacg
tgccagcatcgcaaccggattgcacttcaggcggatgtgttgagcggcgccgcatgcggc
atcaccaatttcctggcaatgaccggcgatcaccccaagattggcgatcatcccgatgcc
aagaatgtgctggacctcaactcgttccagttgctcaaaatgctgcgcaccatgcgtgat
gaaggaaagtttcaatcgggtgtcgcgctgaccgagccgccccgcttctttcttggcggc
gtcgccaatccgaatatcgagcgcgttgcccgtcttgaacgcaagattcagttcggcgcc
gagttcattcagacgcagattctgtttgatcttgatcgcttccggcaatggatggcggat
gctcgcgccgccggactgcaccagaaagcgtacattcttgcaggcatcatggtggtgaaa
tcggcgcagtcggcgcgctttctgcgcgatcatctgcccgggtcgcgcgtgcccgaatgg
gttatcgagcggatggagcgcgccgatcaccccgaagaagaagggattgccatcgctgcc
gaacttacccgcgagctgcttgccatcgaaggggtgcgcggtgttcatgtcatgtcggtc
ggatggacaaaagctattccacaggtggtcgagcgcgccgggttgctgccgcgccctccc
ttgccgccggataatcccaatgacgattga

DBGET integrated database retrieval system