KEGG   Roseiflexus castenholzii: Rcas_4124
Entry
Rcas_4124         CDS       T00585                                 

Name
(GenBank) ABC transporter related
  KO
K01552  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
rca  Roseiflexus castenholzii
Brite
KEGG Orthology (KO) [BR:rca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rca02000]
    Rcas_4124
Transporters [BR:rca02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Rcas_4124
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 SMC_N AAA_30 AAA_18 Zeta_toxin RsgA_GTPase AAA_22 AAA_25 AAA_28 AAA_23 Mg_chelatase DO-GTPase2 CPT
Other DBs
NCBI-ProteinID: ABU60156
UniProt: A7NRG0
Position
5337059..5338639
AA seq 526 aa
MRPLVVCDEATYRYRDGTLALDRVSLAIETGEFVVLAGASGSGKSTLCRLLNGLIPHLHG
GDLTGRVLIAGQDVRSTPPYALSRSVGLALQNPEAQSLATTVARDLALGPACHGLDRATI
AARVREVAALLRIEPLLDRQPVTLSGGELQRVAIAGVLALHPQVLALDEPFAFLDAAGAM
RLRETLRMLHERGVAIIVAEHRLADVADLATRLIVLHEGRIVADGAPRTVLAGDVSQWGV
EAPPWARLAHVAGIDAMSPTLDGALDLASPNGSALHSSPHNAPVTPPALNWDDVSFARND
RIVLHQAYLSAAAGEIVGVLGANGAGKTTLLKLGNGLLRPQRGTVRVQGQAIGQRPLWEV
ARSVGLVGQQPGHMLFAPTVQDELEAGPRALRRVDRAWIGHVIEQCRLEPLLHRSPHHLS
AGEQRRVAIGAVLASQPSALLLDEPTSGQDALNRKALQKIIGDIARDGMAVVIATHDTEW
AYALCTRWAVLDAGRIIASGAPSAICAQPAIVAQARLRLPMAEAIR
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgagaccattggttgtctgcgatgaggcgacctatcggtatcgagacggaacgctcgcc
ctggatcgtgtgtcgcttgccatcgaaacgggagagttcgtggtgctggcaggcgcgagc
gggtcgggcaaatccaccctctgtcgcctgctcaacggtctcattccgcacctccacggc
ggcgatctgaccgggcgcgtcctgattgcggggcaggatgttcgctcgacgccaccctat
gctctgagccgcagtgtggggctggcgttgcagaaccccgaagcgcagagcctggcaaca
actgttgcccgcgatctggcgctcggtcctgcatgccacgggcttgaccgcgcgacgatt
gctgcgcgcgtccgcgaggttgctgcgctattaaggattgaaccgctccttgatcgccaa
ccggtcacactgtcgggaggggaattgcagcgggtagccattgccggagtgctggcgctc
catccacaggtgctggcgctcgatgagccgtttgcgtttctcgacgccgccggcgctatg
cggttgcgcgagacattgcgcatgctccatgaacggggggtcgccattatcgttgccgaa
caccgtctggcagacgtagcagacctggcgacgcgcctgatcgtccttcacgaaggtcgg
atcgtggcagatggcgcgccgcgaacggtgctggcaggcgatgtgtcacagtggggagta
gaagcgccaccatgggcgcgcctggcgcatgttgccgggatagatgcgatgtcgccgacg
cttgatggagcgcttgatctggcgtcgccgaacggcagtgcgctccattcgtcaccgcac
aatgcaccggttacaccgccagcgcttaactgggatgacgtatcatttgcgcgcaacgac
aggatagtgctgcatcaggcgtacctgtcggcagcggcgggggaaattgttggggtgctg
ggcgcgaatggcgcgggtaaaacgacgctgctcaagctgggcaacgggttgcttcggcca
caacgcggaacggtgcgtgttcagggacaggcaatcgggcaacgtccgctctgggaggtc
gcgcgcagtgtcggtctggtgggacaacagccgggacatatgctgtttgcgccgacggtg
caggacgaactggaggcgggaccacgggcgctccggcgagttgatcgcgcctggatcggc
cacgtgatcgagcagtgccgtctggaaccgttgctccaccgttcgccacatcatttgagc
gcgggcgaacagcggcgcgtggcaatcggggctgtgctggcgtcgcaaccatccgcgctg
ctcctcgacgagccgacatccgggcaggatgcgctcaaccgaaaggctttgcaaaagatc
attggcgacatcgcccgcgatggaatggcggtcgttatcgccactcacgacactgaatgg
gcatatgcgctctgcacccgctgggcagtgctggatgccggcaggatcattgcgagcggc
gcgccatcggcaatatgcgcgcaaccggcaatcgtcgcgcaggcgcgccttcgcctccca
atggcagaggcgatccggtag

DBGET integrated database retrieval system