KEGG   Roseiflexus castenholzii: Rcas_4125
Entry
Rcas_4125         CDS       T00585                                 

Name
(GenBank) cobalt transport protein
Organism
rca  Roseiflexus castenholzii
SSDB
Motif
Pfam: CbiQ
Other DBs
NCBI-ProteinID: ABU60157
UniProt: A7NRG1
Position
5340649..5341302
AA seq 217 aa
MASRFDPRAKALSYLIGSAAIILSTDLIRLAFLSGGLALLLIGIGLGRRWLQVMKALTPT
LMLFALVAGWSGGFDAAIGAALRLTALVGAGVLFFGVTPPEELGDALLASGVPSQIAFLL
EGALRFTPMMGTLAREVYEAQASRGIRFDGRHLLRNGPLLLTPLLLSVMRFADDLAEGLE
TRGFGSPQRTPLRDYRLGWRDGALIGVALLLTILIVW
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcttcacgctttgatccacgcgcgaaagcgctatcgtacctgatcggctcagcagcg
atcattctgagcaccgacctgatccgacttgctttcctcagcggcgggctggcactcttg
ctgattggaatcggactggggcggcgctggttgcaggtgatgaaggcgctgacgccgaca
ctcatgctctttgcactggttgccggatggagcggcggtttcgatgcagcgattggcgct
gcgttgcgtctgacagcgcttgtcggcgcaggagtcctgttctttggcgtcacgccgcca
gaagaactgggagatgcgctcctggcgagcggcgtgccgtcgcagatcgcgtttctgctg
gaaggagcgctgcgcttcacgccaatgatggggacgctggcgcgcgaagtgtatgaagcg
caagcgagtcgcggcattcgcttcgacgggcggcatctcctgcgcaacggaccgctcctg
ttgacgccgcttctgctcagcgtgatgcgcttcgccgatgatctggcagaaggtttggaa
acgcgcggcttcggcagcccgcagcgcacaccactgcgcgactaccggctcggatggcgg
gatggagcactgattggcgttgcactgttgctgacgatactcattgtatggtaa

DBGET integrated database retrieval system