KEGG   Rickettsia canadensis CA410: RCA_02885Help
Entry
RCA_02885         CDS       T01736                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rcc  Rickettsia canadensis CA410
Pathway
rcc00020  Citrate cycle (TCA cycle)
rcc00640  Propanoate metabolism
rcc01100  Metabolic pathways
rcc01110  Biosynthesis of secondary metabolites
rcc01120  Microbial metabolism in diverse environments
rcc01130  Biosynthesis of antibiotics
rcc01200  Carbon metabolism
Module
rcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rcc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RCA_02885 (sucC)
   00640 Propanoate metabolism
    RCA_02885 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RCA_02885 (sucC)
Enzymes [BR:rcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RCA_02885 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFB21144
Position
651356..652516
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEQINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKIAHDMFGINLVTHQTGPQGQKVKRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTSGGVDIEEVAKKTPEKIVKFSVDPATGLQDFHMRGIAYELGFKDNQVKQMKEI
VKSVYNAFIETDAAQIEINPLIVKTDGDLLALDAKITFDENALFKHPNVTAMRDYDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGALPANFLDVGGGADCERIKE
AFKIILSDKKVQGVLVNIFGGIMRCDIISEGIIAAAKEIDIKVPLVVRLAGTNVEKGKKI
LSNSGLEIIPAHDLADAANKIVEAIS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggtgtacctacttcc
accggactagttgtgacgaaaaccgaacagattaatgaaaccatagataagttaaatacg
gaagtatatgtagttaaggcacaaatacatgccggcggtagaggtaaagcgggcggtgtt
aaggttgttaagagtaaagaagaagccaagaaaattgctcatgacatgtttggcattaat
ttagtaacacatcaaacaggacctcaaggacagaaagtaaaacgtctttatattgaatca
ggttgtgatattttaaaagaatattattttagtatcgtatttgatagatcagctagctgt
attactttcatagcttctacctcaggaggagttgatattgaagaagtagcaaaaaaaact
ccggaaaaaattgttaaattttctgttgatcctgcaacaggtttacaagattttcatatg
cgaggcatagcttatgagctaggctttaaggataaccaagttaaacagatgaaagaaata
gtaaaatcggtatataatgcttttattgaaactgatgcagcacaaattgaaattaatcct
ttaattgtaaaaaccgacggtgatctactcgctttagacgcaaaaatcacttttgatgag
aacgccctattcaaacaccctaatgtcaccgccatgcgtgattacgatgaggaagatcct
ctagaaactagagcggcaaatgcaggacttagttatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgccggtcttgccatggctactatggatattattaaactttatggt
gctttgcctgctaatttcttggatgtcggcggtggagccgattgtgagcgtataaaagaa
gcttttaaaataattttatctgataaaaaagtacaaggagtcttagttaatattttcggc
ggtattatgcgttgtgatattatatcggaaggaattattgcagctgcaaaagaaatagat
ataaaagtgccgttagtggttcgtttagccggtacaaacgttgaaaaaggcaaaaaaatt
ttatcaaattctggtttagaaataataccggcacatgatttagcagatgccgcaaataaa
atagttgaggctataagctag

DBGET integrated database retrieval system