KEGG   Rhodospirillum centenum: RC1_0021Help
Entry
RC1_0021          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF421 FUSC_2
Motif
Other DBs
NCBI-ProteinID: ACI97472
UniProt: B6IPT6
Position
complement(11192..11731)
Genome map
AA seq 179 aa AA seqDB search
MLFDSWSGLGRVLLVGTLAYLALVLLLRVSGKRTLTKMNAFDLVVTVALGSTLATVLLSK
SVALAEGILALALLIFLQFAITWAQVRSSGVQALIKAEPTLVLHRGRFLEGALRAQRLTR
EEVLAAMRGSGVAMPEQAYAVVLETDGSVSVIRSRPETAGEGGTLPGVAVPDGAGRLAG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcgacagttggtcagggctggggcgcgtgctgctggtgggcaccctggcctat
ctggccctggtcctgctgctgcgggtctcgggcaagcgcaccctgacgaagatgaacgcc
ttcgacctggtggtgacggtcgcgctcggctccaccctggcaacggtgctgctgagcaag
tccgtcgccctggccgagggcatcctcgcgctggcgctgctgatcttcctccagttcgcc
atcacctgggcacaggtgcggtcgtccggggtccaggctctgatcaaggccgagccgacc
ctggtgctgcaccgcggtcgcttcctggagggggcactgcgggcccaacggctgacccgg
gaggaggtgctggcggcgatgcggggaagcggcgtggcgatgcccgaacaggcctatgcc
gtggtgctggagacggacggctccgtcagcgtcatccgctcacggccggagacggcgggc
gaaggcggcaccttgcccggcgtggcggtgccggacggagcgggacggctggccggctga

DBGET integrated database retrieval system