KEGG   Rhodospirillum centenum: RC1_0024Help
Entry
RC1_0024          CDS       T00785                                 

Definition
(GenBank) ABC transporter, ATP-binding protein, putative
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
rce  Rhodospirillum centenum
Brite
KEGG Orthology (KO) [BR:rce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rce02000]
    RC1_0024
Transporters [BR:rce02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    RC1_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_16 SMC_N Zeta_toxin AAA_29 AAA_22 AAA_30 MMR_HSR1 RsgA_GTPase DUF815 SbcCD_C DUF87 ABC_ATPase G-alpha
Motif
Other DBs
NCBI-ProteinID: ACI97475
UniProt: B6IPT9
Position
13233..15074
Genome map
AA seq 613 aa AA seqDB search
MRAVRIDSLEDQDRAFSWEDAESVRPLERRPFRFIWSLMREKFAGRFALMVAAVVAGQAI
EAFEPYALKGLIDGLTAASAGQPVEGIGIVGWFVLLLGIWFFGIGMYRVYQVVDIYTSPS
IRALAQKRMFGWLMGHSHTYFQDNFAGKLGQKIKQGANAILGIIEIMMFDMIRTAVLLAV
AVVLLWTAAPAFSAFLMAWAVLYIAVSGWLARHCFRLSEQMSEAVSTSSGRIIDAITNAD
LIRGFARIAFERSFLGHWINAERFRSRRLRWYLVVMRLFQMASIIVLLGVLVWVALDRTL
AGTMTVGEFTLVFTLGFQISNTVWHLSDRLLSFFEELGTLSEALDLVSAPHGIVDAPGAT
PLVVTEGRIEVRDLRFSFPDGTKVFDGLSLTIRPGEKIGLVGRSGAGKSTLVKLIRRQYE
PQGGAVLIDGQDIATVTQESLNAAIAEVPQQPGVFHRTIGENIAYGRLGATQAEVEEAAR
QAHAHEFIARRPTGYDTVVGEQGVKLSGGERQRVAIARALLKDARILVLDEATSALDSES
EHLIQGALWTLMQGRTVIAIAHRLSTITGMDRILYVEGGRIVEQGSHADLLALGGRYAAL
WQRQSGGFLEAAE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtccgcatcgacagcctggaggaccaggaccgcgccttctcctgggaggat
gcggagagcgtgcgtccgctggagcggcggccgttccgcttcatctggtcgctcatgcgg
gagaagttcgccggccgctttgcgctcatggtggcggccgtggtggccggacaggcgatc
gaggcgttcgagccctatgccctgaagggcctgatcgacgggctgaccgcggccagcgcg
ggccagccggtggagggcatcggcatcgtcggctggttcgtgctgctgctcggcatctgg
ttcttcggcatcggcatgtaccgcgtctaccaggtcgtggacatctacacctcgccctcg
atccgggcgctggcgcagaagcgcatgttcggctggctgatggggcacagccacacctac
ttccaggacaacttcgccgggaagctgggccagaagatcaagcagggcgccaacgccatc
ctgggcatcatcgagatcatgatgttcgacatgatccggacggcggtgctgctggccgtg
gcggtcgtgctgctgtggaccgcggccccggcgttctcggccttcctgatggcgtgggcg
gtgctctacatcgccgtcagcggctggctggcgcggcactgcttccgcctgtcggagcag
atgagcgaggcggtctccaccagttccggccggatcatcgacgcgatcaccaacgccgac
ctgatccgcggcttcgcccgcatcgccttcgagcgcagcttcctgggccactggatcaac
gccgagcggttccgctcgcggcggctgcgctggtatctcgtggtgatgcggctgttccag
atggccagcatcatcgtgctgctgggcgtgctggtctgggtggcgctggaccggaccctg
gccgggacgatgacggtgggcgagttcacgctcgtcttcaccctgggcttccagatctcc
aacacggtctggcacctgtccgaccggctgctgagcttcttcgaggagctgggcacgctc
tcggaggcgctggatctggtgtcggccccgcatggcatcgtggacgcgccgggggctacg
ccgctggtcgtgacggaggggcggatcgaggtccgcgatctgcgcttcagcttccccgac
gggacgaaggtcttcgacgggctgtcgctgaccatccggccgggggagaagatcgggctg
gtcggccgctcgggtgccggcaagtccacgctcgtcaagctgatccgacggcagtacgag
ccgcagggcggggcggtgctgatcgacgggcaggacatcgccaccgtcacgcaggaaagc
ctgaacgccgccatcgcggaggtgccgcagcagcccggcgtcttccaccgcaccatcggc
gagaacatcgcctacggccgcctgggcgcgacccaggcggaggtggaagaggccgcccgg
caggcgcacgcccacgagttcatcgcccggcggcccaccggctacgacaccgtcgtcggc
gagcagggcgtgaagctctccggcggcgagcggcagcgtgtggcgatcgcccgcgccctg
ctgaaggacgcgcgcatcctggtgctggacgaggcgacctcggcgctcgacagcgagtcc
gagcacctgatccagggggcgctgtggacgctgatgcaggggcggaccgtcatcgccatc
gcgcaccggctctcgacgatcacggggatggaccgcatcctctatgtcgaaggcggccgc
atcgtggagcagggaagccatgccgatctgctggcgctggggggccgctatgcggccctc
tggcaacggcagagcggcgggttcctggaggctgcggagtaa

DBGET integrated database retrieval system