KEGG   Rhodospirillum centenum: RC1_0028Help
Entry
RC1_0028          CDS       T00785                                 

Definition
(GenBank) glucose/sorbosone dehydrogenase, putative
  KO
K21430  aldose sugar dehydrogenase [EC:1.1.5.-]
Organism
rce  Rhodospirillum centenum
Brite
KEGG Orthology (KO) [BR:rce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RC1_0028
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.-  
     RC1_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSDH NHL
Motif
Other DBs
NCBI-ProteinID: ACI97479
UniProt: B6IPU3
Position
19580..20725
Genome map
AA seq 381 aa AA seqDB search
MAVGLAAVGPVLGVPVSAGALAAPREFNAWPAPAARQAVKVTTVVDGLDHPWSVAFLPDG
RLLVTERTGRLRTVQEGRLLPEPVAGLPPIEEVGQGGLLEVALHPDHARNRLVYISYAEP
DPSGRGHRTAIARFRDGNGTAEGFEVLYRGTSDRTRHHFGSRIVFGTDGKLYFSIGDRGT
DKRAQDPADSSGSILRLNDDGSIPGDNPFVGRPGHLPELYSMGNRNPQGLAVQPGTGLIW
ESEHGPQGGDEINIIRAGANYGWPVITYGRTYGLGLPIGEGTEKPGMVQPELYFVPSLAL
AGMTFYTGDALPAWKGDLIVALLGGGLVRLDVEDDRVVAAERLLEEELGRTRHVAQGPDG
ALYALVDEPAPGGRLVRIDPQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtggggctggccgcggtcggcccggtcctcggcgttccggtatccgccggcgcc
ctggcggccccgcgggagttcaacgcctggccggcccccgccgcgcggcaggcggtcaag
gtcaccaccgtcgtggacgggctggaccacccctggagcgtcgccttcctgcccgacgga
cgcctgctggtcaccgagcgtaccggccggctgcgcaccgtgcaggaggggcgcctgctg
cctgagccggtggccggcctgccgcccatcgaggaggtggggcagggcggtctgctggag
gtggcgctgcaccccgaccatgcgcgcaaccgccttgtctacatctcctatgccgagccc
gatccgtcggggcgcggccaccgcaccgccatcgcccgcttccgtgacggcaacggcacg
gcggaaggcttcgaggtgctgtaccgcggcaccagcgaccgcacgcgccaccatttcggc
agccggatcgtcttcggcacggacggcaagctctatttcagcatcggcgaccgcggcacg
gacaagcgggcgcaggacccggccgacagctccggcagcatcctgcgcctgaacgatgac
ggcagcatccccggggacaatcccttcgtcggcaggcccggtcatctgcccgagctgtac
agcatgggcaaccgcaatccgcaggggctggcggtgcagccgggcaccggcctgatctgg
gaatcggagcacggcccccagggcggggacgagatcaacatcatccgcgccggcgcgaac
tacggctggcccgtcatcacctacggccggacctacggcctcggcctgccgatcggggag
ggcacggagaagccggggatggtgcagccggaactctacttcgtgccgtcgctggcgctc
gcgggcatgaccttctacacgggcgacgcgctgccggcctggaagggcgacctgatcgtc
gccctgctgggcggcggtctcgtccgcctggacgtggaagacgaccgcgtggtcgccgcc
gagcgcctgctggaggaggagctgggacgcacccgccatgtggcgcaggggccggacggt
gcgctctacgccctggtggacgagccggcgcccggcggcaggctggtccgcatcgatccg
cagtga

DBGET integrated database retrieval system