KEGG   Rhodospirillum centenum: RC1_0030Help
Entry
RC1_0030          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3313
Motif
Other DBs
NCBI-ProteinID: ACI97481
UniProt: B6IPU5
Position
complement(22431..23126)
Genome map
AA seq 231 aa AA seqDB search
MQDTAVQAPAFFRPAAVRFAAVVLVALAVAAPAVAKVASQDVRGAPPVPELPLQGLEQRP
LSGMDIFSVRPGTDLSRYDRVLIDPIGLSVTRRHEDLALTERDAEHARSYFREKLEQEFG
ARALAAQPGPGVLRLSLLITEFVPNSPVFPERQDGRGGIIHRTYGVGEAAFQAVLTDAMT
GEVVAVFADSDTGQPLGQNLHATTQYGDADRFIRRWAAQIASAVTGGSGQG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggacaccgcggtccaggctcccgcgttcttccggcctgcggccgtccgcttcgcg
gccgttgtcctggtcgcgctcgcggtggcggcgccggccgtcgccaaggtggccagccag
gatgtccgcggcgccccgccggtacccgagctgcccctccagggcctggaacagcgcccg
ctgagcggcatggacatcttctctgtgcgccccggcacggacctgtcgcgctatgaccgg
gtcctgatcgaccccatcgggctgtccgtcacccgccggcatgaggatctggccctgacg
gaacgcgatgccgagcatgcccgcagctacttccgggagaagctggagcaggagttcggc
gccagggcgcttgccgcgcagccggggccgggcgtgctccggctgagcctcctgatcacg
gaattcgtaccgaacagccccgtcttcccggaacggcaggacgggcgcggcggcatcatc
caccgcacctacggcgtgggcgaggcggctttccaggcggtgctgacggatgccatgacg
ggcgaggtggtcgccgtcttcgccgactcggacacgggccagccgctcggtcagaatctc
catgcgacgacgcagtacggcgatgccgaccgcttcatccggcgctgggcggcacagatc
gcctccgccgtcacgggcggcagcggccagggctga

DBGET integrated database retrieval system