KEGG   Rhodospirillum centenum: RC1_0032Help
Entry
RC1_0032          CDS       T00785                                 

Definition
(GenBank) phage-related hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI97482
UniProt: B6IPU6
Position
complement(23904..24107)
Genome map
AA seq 67 aa AA seqDB search
MATLRDIADAEAVTVPFVSRFLRLAYLSPEVLEHLLIHRRPCALSLERLAAKALAPWVEQ
PGMVFEE
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgctaagggacatcgccgacgccgaggccgtcacggtgcccttcgttagccgg
ttcctgcggctggcctacctgtcgccggaagtgctggagcacctgctgatccaccggcgc
ccgtgcgccctgtctctggagcggctggcggcgaaggcgctggcgccctgggtcgagcag
ccgggcatggtgttcgaagaataa

DBGET integrated database retrieval system