KEGG   Rhodospirillum centenum: RC1_0039Help
Entry
RC1_0039          CDS       T00785                                 

Definition
(GenBank) putative transcriptional regulator, XRE family
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_25
Motif
Other DBs
NCBI-ProteinID: ACI97489
UniProt: B6IPV3
Position
29140..29463
Genome map
AA seq 107 aa AA seqDB search
MTQTPTTFGQAIAQARKAKGLSQKELAARIVKDEGGNISPQYLNDIEHDRRSPSSDHLIR
QFAAELGMDDNILFILAGKIPDETRRNVKDLMKAADAFMNFRRDASN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccccgacgaccttcggacaggcaattgctcaggctcggaaggccaaaggc
ctcagccagaaggaactggcggcgcgcatcgtcaaggacgaaggcggaaatatctcgccg
caatacctgaacgacatcgaacatgatcgtcggagcccgtcctccgatcatctgatacgg
cagttcgcggcggaactcggcatggacgacaacatcctgttcatcctggccgggaaaatt
cctgacgagacccggcgcaacgtgaaggatttgatgaaggccgccgatgccttcatgaac
ttccggcgcgacgcatccaactga

DBGET integrated database retrieval system