KEGG   Rhodospirillum centenum: RC1_0043Help
Entry
RC1_0043          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 HTH_23 HTH_Tnp_4 MerR_1 ANAPC_CDC26
Motif
Other DBs
NCBI-ProteinID: ACI97493
UniProt: B6IPV7
Position
32554..32739
Genome map
AA seq 61 aa AA seqDB search
MAVSHLTQTDLARRWRISPRTLERWRWLGQGPKYLKIGGRVVYRLEDIEAFEAEKQREAV
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcagtcatttgacacagaccgacctggcccgacgctggcggatcagcccgcgc
accctggagcgctggcgctggctgggacaggggccgaaatacctgaagatcggcggccgc
gtcgtctaccgcctggaagacatcgaggccttcgaagctgagaagcagcgggaggcggtc
gcatga

DBGET integrated database retrieval system