KEGG   Rhodospirillum centenum: RC1_0049Help
Entry
RC1_0049          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACI97499
UniProt: B6IPW3
Position
35680..36045
Genome map
AA seq 121 aa AA seqDB search
MRLCSVCDREGRGFLYSHPGHPDRLHRFCSMGCLDAGARLAKENNGMIDKTAREVQALKD
ARRPFAEALTELGLMDPFFHRTAAEIDRLIEAAVTGYVDSMQRRAGVRERTGTALDDPLP
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctctgctcggtctgcgaccgggagggccgcggcttcctctacagccatcccggc
catcccgaccggctccaccgcttctgctccatgggctgcctcgatgccggcgcccgtctg
gcaaaggagaacaacggcatgatcgacaaaaccgcgcgggaggtgcaggcgctgaaggac
gcccgccgcccgttcgccgaggccctgaccgagctcgggctgatggaccccttcttccac
cgtaccgctgccgagatcgaccgcctgatcgaggcggccgtcaccggctacgtcgacagc
atgcagcggcgggccggtgtgcgggagcggaccggcaccgcgctggacgaccctttgcct
ttttga

DBGET integrated database retrieval system