KEGG   Rhodospirillum centenum: RC1_0061Help
Entry
RC1_0061          CDS       T00785                                 

Definition
(GenBank) DNA methylase, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_N4_Mtase ParBc UPF0020
Motif
Other DBs
NCBI-ProteinID: ACI97511
UniProt: B6IPX5
Position
48797..50035
Genome map
AA seq 412 aa AA seqDB search
MLNDIRIERWPLDRLLPYAANARTHSEAQVAEIAGSIREFGFNNPVLVDDRGVLIAGHGR
LLAARRLGLAEVPVIRLGHLTETQARAFRLADNRIALNGGWDDALLSAELARLVEEGTAL
DGLGFDAGELNRLLNLDDPAPGLVDEDATPEPPAEPVTRPGDLWILGSHRLLCGDATGAS
DVERLLAGARPHLMVTDPPYGVEYDPSWRNAAGVAKTKRTGKVANDDRADWRDAWALFPG
DVAYVWHAAIHATTVAESLIACGFDIRAQIVWSKSRFALGRGDYHWQHEPCWYGVRKGAK
SHWQGARDQSTLWSIAPAGGEDAATPHGTQKPVEVMRRPIVNNSARGDVLYEPFCGSGTT
LIAAETVGRVCYALELDPTYCDVIVRRWEGFTGQRATRADGTPFSDGTDAGA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgatatccggatcgaacgctggccgctggaccggctgctgccctatgccgcc
aacgcgcgcacccattccgaggcacaggtggcggagatcgcgggctccatccgcgagttc
ggcttcaacaacccggtgctggttgatgatcgcggcgtgctgatcgccgggcacggacgg
ctgctggcggcccggcgactggggctggctgaagtgccggtgatccggctcggccacctg
accgagacgcaggcccgcgccttccgcctggccgacaaccgcatcgccctgaacggtggc
tgggatgatgcgctgctgtcggccgaactggcgcggctggtggaggaaggcaccgcgctg
gacgggctcggcttcgacgccggggaactgaaccggctgctgaacctggacgatccggcg
ccagggctggtggacgaggacgccacgccggaaccgcccgccgagcccgtgacccggccg
ggggatctctggatccttggttcccatcggctgctgtgcggcgatgccacgggcgccagc
gatgtcgagcggctgctggccggtgcgcggcctcacctgatggtgaccgatccgccctat
ggcgtggagtacgatccctcctggcgcaacgcggcgggggtggcgaagacgaagcgcacc
ggcaaggtcgccaacgacgaccgcgccgactggcgcgatgcctgggcgctgtttcccggc
gacgtcgcctatgtctggcacgctgccatccacgccaccacggtggccgaaagcctgatc
gcctgcggcttcgacatccgggcccagatcgtctggtcgaagagccgcttcgcgctcgga
cgcggggattatcactggcagcatgagccgtgctggtacggcgtgcgcaagggcgcgaag
agccactggcagggtgcccgcgaccagtcgaccctgtggtcgatcgccccggccggcggc
gaggacgccgccacgccccacggcacccagaagccggtggaggtgatgcgccgccccatc
gtcaacaacagcgcgcggggcgatgtcctctatgaacccttctgcggttccggcaccacc
ctgatcgccgccgagacggtggggcgggtctgctacgccctggaactggatccgacctat
tgcgacgtgatcgtgcggcggtgggaggggttcacgggccaaagggcaacccgcgcggac
gggacgccgttttccgacggaacggatgccggtgcatga

DBGET integrated database retrieval system