KEGG   Rhodospirillum centenum: RC1_0065Help
Entry
RC1_0065          CDS       T00785                                 

Gene name
nu1
Definition
(GenBank) probable terminase small subunit, Nu1
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_Nu1 DUF1441 MerR HTH_17 Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: ACI97514
UniProt: B6IPX8
Position
52023..52613
Genome map
AA seq 196 aa AA seqDB search
MAGNGQPLAVIAKLLDLSERRVQQLSREGVIPKAERGAYDLVGAVRGYVRYLRDLAQRAQ
GGVADLPTERTRLVKAKADLAELDAQQRRGDLVPVAETALAWAAVTARLRARLITLPDKL
APLVHDAANPAAVRVLLRSAIVEALAELAATPVAVAPAPDRASGAGEAGDDGVADADAAA
GPDGEPMGGRQPPAEF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgggcagccgctggcggtgatcgccaagctgctcgacctgtcggagcgc
cgggtccagcagctcagccgcgagggggtgatccccaaggccgagcgcggcgcctacgat
ctggtcggcgccgtgcgcggctatgtgcgctacctgcgcgatctggcgcagcgggcgcag
ggtggcgtcgccgacctgcccaccgaacgcacccggctggtcaaggccaaggccgacctt
gccgaactggacgcgcagcaacggcgcggcgatctggtgccggtggccgagacggcgctg
gcctgggcggcagtgacggcccggctgcgcgcccgcctgatcaccctgccggacaagctg
gcccccctggttcatgatgccgcaaaccccgccgccgtccgcgtccttctccggtcggcg
attgtcgaggcgctcgccgaacttgcggcgacgccggtcgccgtcgcccctgcgcctgac
cgggcatccggggctggcgaagctggtgacgacggcgttgcagatgctgacgccgccgcc
ggacctgacggtgagccaatgggcggacgccaaccgccggctgagttctga

DBGET integrated database retrieval system