KEGG   Rhodospirillum centenum: RC1_0239Help
Entry
RC1_0239          CDS       T00785                                 

Gene name
cbbL2
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rce  Rhodospirillum centenum
Pathway
rce00630  Glyoxylate and dicarboxylate metabolism
rce00710  Carbon fixation in photosynthetic organisms
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
Module
rce_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rce_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rce_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_0239 (cbbL2)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_0239 (cbbL2)
Enzymes [BR:rce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RC1_0239 (cbbL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACI97688
UniProt: B6IQF2
Position
228179..229597
Genome map
AA seq 472 aa AA seqDB search
MGKTYQAGVKEYRETYWDPNYTPKDSDILACFKVVPQPGVPREEAAAAVCAESSTATWTT
VWTDLLTDLDYYKGRAYAIEDVPGDDEAFYAFVAYPMGLFEEGSIVNVFTSLVGNVFGFK
AVRSLRLEDVRFPLWFVTTCDGPPHGIQVERDKLDKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCQEAIEKAEAETGERKGHYLNVTAPNME
EIYRRAEYAKEIGSPIIMSDYLTIGWAAHSSLSRWCRNNGMLLHVHRAMHGVIDRNPRHG
INFRVLAKLLRLLGGDHLHSGTVVGKLEGDREATLGWVDLMRERHVKEDRSRGLFFDQEW
GHMAPVMPVASGGIHVWHMPALLSIFGDDAVFQFGGGTLGHPWGNAAGACANRVALEACV
EARNQGRDVEREGKDILTAAARHSPELKMAMETWKEVRFEFDVVDKLDVVHR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacctatcaggcaggcgtcaaagagtaccgtgagacctactgggacccgaac
tacacgccgaaggacagcgacatcctggcctgcttcaaggtggtcccgcagccgggggtc
ccgcgcgaagaagccgcagcggccgtctgcgccgaatcctccaccgcgacctggaccacg
gtctggaccgacctgctgaccgacctcgactactacaagggccgggcctacgcgatcgag
gacgtgccgggcgatgacgaggcgttctacgccttcgtggcctacccgatgggcctgttc
gaggagggctccatcgtcaacgtcttcacctcgctggtcggcaacgtcttcggcttcaag
gcggtgcgctccctgcggctggaggatgtgcgcttcccgctctggttcgtcaccacctgc
gacggcccgccccacggcatccaggtcgagcgcgacaagctggacaagtacggccgcccg
ctgctgggctgcacgatcaagccgaagctcgggctgtcggcgaagaactacggccgggcg
gtctatgagtgcctgcgcggcggcctggacttcaccaaggacgacgagaacgtcaactcc
cagcccttcatgcgctggcgcgaccgcttcctgttctgccaggaggcgatcgagaaggcc
gaggcggagaccggcgagcgcaagggccactacctgaacgtcacagcgcccaacatggag
gagatctaccgccgggccgagtacgccaaggagatcggctcgccgatcatcatgagcgac
tatctgacgatcggctgggcggcccattccagcctgtcgcgctggtgccgcaacaacggg
atgctgctgcacgtccaccgggcgatgcacggcgtcatcgaccgcaacccgcggcacggc
atcaacttccgggtcctggccaagctgctgcgcctgctgggcggcgaccacctgcattcc
ggcaccgtcgtcggcaagctggaaggcgaccgcgaggcgacgctcggctgggtggacctg
atgcgcgagcgccatgtgaaggaggatcgcagccgcggcctcttcttcgaccaggaatgg
ggccacatggcgccggtcatgccggtcgcttcgggcggcatccatgtctggcacatgccg
gccctgctctcgatcttcggtgacgatgccgtcttccagttcggcggcggcacgctgggg
catccctggggcaacgctgccggcgcctgtgccaaccgcgtggcgctggaggcctgcgtc
gaggcgcgcaaccagggccgcgacgtggagcgcgagggcaaggacatcctgaccgccgcc
gcccgccacagccccgaactgaagatggcgatggagacctggaaggaggtccgcttcgag
ttcgacgtggtggacaagctcgacgtcgtccaccgctga

DBGET integrated database retrieval system