KEGG   Rhodospirillum centenum: RC1_1202Help
Entry
RC1_1202          CDS       T00785                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rce  Rhodospirillum centenum
Pathway
rce00900  Terpenoid backbone biosynthesis
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01130  Biosynthesis of antibiotics
Module
rce_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RC1_1202 (dxr)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RC1_1202 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Epimerase Semialdhyde_dh Ferritin_2
Motif
Other DBs
NCBI-ProteinID: ACI98616
UniProt: B6ISU5
Position
complement(1256709..1257917)
Genome map
AA seq 402 aa AA seqDB search
MVVSVTPRHSTGGDGIRSVTVLGSTGSVGSNTVELIEAYPERYRTVALVARRNVAALAGQ
ARRLRPEVAVVADEAHYADLKDALAGTGIAAAAGPAAVVEAAQRPADWVMAAIVGAAGLE
PTLAAARRGAIVAFANKECLVCAGELLMAEVRRHGATLLPVDSEHSAIFQVFDPERRPAV
SRLILTASGGPFRTWTRERMAAATPKEACAHPNWTMGAKISVDSASMMNKGLEIIEACHL
FGMPDGQIDVLVHPQSVVHSMVEYVDGSVLAQLGTPDMRTPIAVALGWPDRIATPGARLD
LIKSSRLEFEAPDPLRFPALRLARHALQCGGAAPTLLNAANEVAVQAFLEERIGFLDIER
VVEATLASLPHSELNDLDDVRTADADARRFASEMVAAGRGSR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgagcgtgaccccgcggcattcgaccgggggcgatggaatccgcagcgtgacg
gtgctgggctcgaccggatcggtcggcagcaacacggtcgaactgatcgaggcctatccg
gagcgctaccgcacggtggctctggtggcccgccgcaacgtcgccgccctggccggacag
gcccgacgcctgcggcccgaggtcgccgtcgtcgccgatgaggcccactacgccgacctg
aaggacgcgcttgccggtaccggcatcgccgcggcggccggtcctgcggccgtggtcgag
gcggcgcagcgcccggcagactgggtgatggccgccatcgtcggtgccgccgggctggag
ccgaccctggcagccgcccgccgcggcgccatcgtcgccttcgccaacaaggaatgcctc
gtctgtgcgggtgaactgctgatggcggaggtgcgccggcacggcgccacgctgctgccg
gtggacagcgagcacagcgccatcttccaggtcttcgacccggagcgccgaccggcggtc
agccggctgatcctcaccgcgtcgggcggcccgttccgcacctggacgcgcgagcgcatg
gcggctgccacgccgaaggaggcgtgcgcccatccgaactggacgatgggggccaagatc
tccgtcgacagcgccagcatgatgaacaagggcctggagatcatcgaggcctgccacctg
ttcggcatgccggacgggcagatcgacgtgctggtgcatccgcagtcggtcgtccacagc
atggtcgaatatgtggacggctccgtgctggcacagctcggcacgcccgacatgcgcacc
cccatcgccgtggcgctgggctggccggaccgtatcgccacgcccggcgcccggctggac
ctgatcaaatcttcccggctggagttcgaggcgccggatccgctgcgcttcccggcgctg
cggctggcccggcacgcgctccagtgcggcggtgccgcgccgaccctgctgaacgccgcg
aacgaggtggcggtccaggccttcctggaggaacggatcggcttcctggacatcgagcgg
gtcgtcgaggcgacgctcgcatcgctgccacattctgagctcaatgacctggatgatgtg
cgcacagccgatgccgatgcccgccgcttcgcgtccgagatggtcgcggcggggcggggc
agccggtag

DBGET integrated database retrieval system